DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP1 and XTH32

DIOPT Version :9

Sequence 1:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_181224.1 Gene:XTH32 / 818259 AraportID:AT2G36870 Length:299 Species:Arabidopsis thaliana


Alignment Length:228 Identity:45/228 - (19%)
Similarity:72/228 - (31%) Gaps:84/228 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 HNRIKECIL-----HSTGSGPSGIMPPIVTPRISTKETFAFQYGRIEIRAKLPKGDWIVPLLLLE 308
            |.|:.:..|     .::|||...:.|              |:.|......||             
plant    55 HQRMDQNALTIWLDRTSGSGFKSVKP--------------FRSGYFGANIKL------------- 92

  Fly   309 PLTEWYGQSGYESGQLRVALARGNSVLRMPRGKLVDGRSL---YGGP-VLSTDAHQRED------ 363
                   |.||.:|.: .:|...|:.........||...|   :|.| .|.|:.:.|..      
plant    93 -------QPGYTAGVI-TSLYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVYIRGSGDGKII 149

  Fly   364 -------LWLSKRKISHFGDDFHTYSLDWSSNRLLFSVDG-------------------QVYGEM 402
                   ||....|      |||.|::.||...::|.||.                   .:||.:
plant   150 GREMKFRLWFDPTK------DFHHYAILWSPREIIFLVDDIPIRRYPKKSASTFPLRPMWLYGSI 208

  Fly   403 LNGFTELDENPRWKQGGPMAPFDKMF--YISLG 433
            .:..:...|:.::|......||...:  :.:||
plant   209 WDASSWATEDGKYKADYKYQPFTAKYTNFKALG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP1NP_524142.2 CBM39 21..126 CDD:292510
GH16_beta_GRP 175..491 CDD:185688 45/228 (20%)
XTH32NP_181224.1 LamG 39..297 CDD:419873 45/228 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.