powered by:
Protein Alignment GNBP1 and C40A11.8
DIOPT Version :9
Sequence 1: | NP_524142.2 |
Gene: | GNBP1 / 40034 |
FlyBaseID: | FBgn0040323 |
Length: | 492 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001367613.1 |
Gene: | C40A11.8 / 183356 |
WormBaseID: | WBGene00016551 |
Length: | 127 |
Species: | Caenorhabditis elegans |
Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
Similarity: | 15/40 - (37%) |
Gaps: | 8/40 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MPGLCIGILLLIGFGCTTAYKIPTPTVELLETGFSVSIPD 40
:|.:.|..:.||...|...|. .|..||..:||
Worm 69 LPIINILSIPLIYVACLAYYS--------EEVAFSEMVPD 100
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
GNBP1 | NP_524142.2 |
CBM39 |
21..126 |
CDD:292510 |
5/20 (25%) |
GH16_beta_GRP |
175..491 |
CDD:185688 |
|
C40A11.8 | NP_001367613.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1209387at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.