DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP2 and XTH24

DIOPT Version :10

Sequence 1:NP_524141.1 Gene:GNBP2 / 40033 FlyBaseID:FBgn0040322 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_194756.1 Gene:XTH24 / 829150 AraportID:AT4G30270 Length:269 Species:Arabidopsis thaliana


Alignment Length:181 Identity:42/181 - (23%)
Similarity:61/181 - (33%) Gaps:52/181 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 FKFGKIVVRAKLPKGDWLFPYLMLQPVSTYAETHYAKQLRIAYARGNANLRTKQGDDISGNHLYG 335
            :.||||.::.||..|:      ....|:|:            |.:...:...:...:..|| :.|
plant    64 YLFGKIDMQIKLVPGN------SAGTVTTF------------YLKSEGSTWDEIDFEFLGN-MSG 109

  Fly   336 GGVVWHHGNAVQFLKDKISNSHYGDD----FHNYTMIWQRDKITLMVDDEVYGELYDGLPFFN-E 395
            .....|.....|...||....|...|    ||.|:::|...:|.|.|||....|      |.| |
plant   110 DPYTLHTNVYTQGKGDKEQQFHLWFDPTANFHTYSILWNPQRIILTVDDTPIRE------FKNYE 168

  Fly   396 KCFIIFGVTVGGFLNFDDSLLAKDVKPYKNREPRAALSFWQHRDAWAPTWG 446
            ...::|.                     ||:..|...|.| :.|.||...|
plant   169 SLGVLFP---------------------KNKPMRMYASLW-NADDWATRGG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP2NP_524141.1 CBM39 22..120 CDD:464924
GH16_beta_GRP 165..460 CDD:185688 42/181 (23%)
XTH24NP_194756.1 GH16_XET 20..265 CDD:185685 42/181 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.