DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP2 and XTH10

DIOPT Version :10

Sequence 1:NP_524141.1 Gene:GNBP2 / 40033 FlyBaseID:FBgn0040322 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_179069.1 Gene:XTH10 / 815950 AraportID:AT2G14620 Length:299 Species:Arabidopsis thaliana


Alignment Length:207 Identity:45/207 - (21%)
Similarity:72/207 - (34%) Gaps:79/207 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 SFS----FKFGKIVVRAKLPKGD---WLFPYLML--QPVSTYAETHYAKQLRIAYARGNAN---- 319
            |||    |.||:|.::.||.:|.   .:..|.|.  ||.....:..:.         ||.|    
plant    70 SFSSIQTFLFGQIDMKIKLIRGSSQGTVVAYYMSSDQPNRDEIDFEFL---------GNVNGQPY 125

  Fly   320 -LRTKQGDDISGNHLYGGGVVWHHGNAVQFLKDKISNSHY----GDDFHNYTMIWQRDKITLMVD 379
             |:|         ::|..|           |.::....|.    ..|||.|:::|...:|..|||
plant   126 ILQT---------NVYAEG-----------LDNREERIHLWFDPAKDFHTYSILWNIHQIVFMVD 170

  Fly   380 DEVYGELYDGLPFFNEKCFIIFGVTVGGFLNFDDSLLAKDVKPYKNREPRAA-LSFWQHRDAWAP 443
            .                      :.:..:.|..:..:|     |...:|.:. .|.| :.::|| 
plant   171 Q----------------------IPIRLYRNHGEKGVA-----YPRLQPMSVQASLW-NGESWA- 206

  Fly   444 TWGRHSAMVIDY 455
            |.|.|..  ||:
plant   207 TRGGHDK--IDW 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP2NP_524141.1 CBM39 22..120 CDD:464924
GH16_beta_GRP 165..460 CDD:185688 45/207 (22%)
XTH10NP_179069.1 GH16_XET 33..294 CDD:185685 45/207 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.