DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYPT-75D and YCR051W

DIOPT Version :9

Sequence 1:NP_001262018.1 Gene:MYPT-75D / 40032 FlyBaseID:FBgn0036801 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_009980.1 Gene:YCR051W / 850418 SGDID:S000000647 Length:222 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:46/188 - (24%)
Similarity:81/188 - (43%) Gaps:44/188 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 AASRNDMPEVAALLQH---GITPDAANEDGLTAMHQACIDNNVEMLQLLL-EYGANVDAQDSDKW 186
            |||..::..|..:|:.   .:||.:.:.:|.|.||.|....::::|:.:. ||..:::..|:|..
Yeast     8 AASDGNLDRVEHILRESKGAMTPQSKDINGYTPMHAAAAYGHLDLLKKMCNEYNGDINVLDNDGD 72

  Fly   187 TPLHAAATCGHLELV---RILIRH-GANLLAVNTDGNMPYD----------LCD---------DE 228
            ||||      |:|.|   |:::.. |.:....|.:|..|||          |.:         |.
Yeast    73 TPLH------HVEDVATARLIVEELGGDFTIRNVEGQTPYDSFVENGEDGELIEYMRIKSGVADV 131

  Fly   229 KTLDFIEGE-MAQRGVTQELIDETRSSTER----------IMLRDLMELARTGGDLEE 275
            ..:|.::|| :....:.:|..|..|.:.|.          :..|..:|...||.:.||
Yeast   132 HGVDGVQGEGVIDSKLLEEFKDNVRYTLENDPEEGADEATLQRRRQLEQIITGDNAEE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYPT-75DNP_001262018.1 Ank_2 123..215 CDD:289560 26/96 (27%)
ANK repeat 123..149 CDD:293786 7/25 (28%)
ANK 146..332 CDD:238125 39/165 (24%)
ANK repeat 151..182 CDD:293786 8/31 (26%)
ANK repeat 184..215 CDD:293786 10/34 (29%)
ANK repeat 217..310 CDD:293786 19/89 (21%)
Ank_4 282..332 CDD:290365
ANK repeat 312..343 CDD:293786
Ank_4 314..>353 CDD:290365
YCR051WNP_009980.1 ANKYR 1..222 CDD:223738 46/188 (24%)
Ank_2 5..99 CDD:403870 26/96 (27%)
ANK repeat 5..34 CDD:293786 7/25 (28%)
ANK repeat 36..68 CDD:293786 8/31 (26%)
ANK repeat 70..99 CDD:293786 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3610
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.