DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYPT-75D and AT2G31820

DIOPT Version :9

Sequence 1:NP_001262018.1 Gene:MYPT-75D / 40032 FlyBaseID:FBgn0036801 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_180741.1 Gene:AT2G31820 / 817739 AraportID:AT2G31820 Length:662 Species:Arabidopsis thaliana


Alignment Length:438 Identity:99/438 - (22%)
Similarity:185/438 - (42%) Gaps:79/438 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGILIQ--RKSQEDASYTKQLKMEHADLVAEMQTV-ESLPTHERLQLARLRRAQQLKLSRQK--- 61
            :|:.::  ::|:...|..||......::....:.| |.||:..|..:.|.:..:...|.:||   
plant    63 QGVNVENYQQSRLGRSMEKQQSFRGVNVENHKRGVMEKLPSFGRATMERQKSFRGGFLEKQKSFR 127

  Fly    62 ---DKEWAKL-QRAKGNTASGGSGTGSL------GN-----GLMNGNGDTTHHFRHANGSGTLSG 111
               :::.:.: :|.|.|.:.|..|..||      ||     .|:.|.||   ..:.......|.|
plant   128 VVMERQLSFIGERRKKNESPGKRGDSSLHIAARTGNLSKVKELIRGCGD---ELKELLSKQNLEG 189

  Fly   112 RR--HISFEN--SVVLLEAASRNDMPEVAALLQHGITPDAANEDGLTAMHQACIDNNVEMLQLLL 172
            ..  :.:.||  |:|:.|.....|:...:...::|..|          .|.|....::|:|::||
plant   190 ETPLYTAAENGHSIVVEEMLKHMDLETASIAARNGFDP----------FHVAAKQGHLEVLKILL 244

  Fly   173 EYGANVD-AQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDEKTLDFIEG 236
            |...|:. ..|....|.||.|||.||:::|.:|:         .||.|:.....::.||......
plant   245 ETFPNLAMTTDLSCTTALHTAATQGHIDVVNLLL---------ETDSNLAKIAKNNGKTALHSAA 300

  Fly   237 EMAQRGVTQELIDETRSSTERIMLR--DLMELARTGG------DLEEPDYQCA--------TPLH 285
            .|....|.:.||.:..|...|...:  ..:.:|..|.      :|.:||....        ||||
plant   301 RMGHVEVVKSLIGKDPSIGFRTDKKGQTALHMAVKGQNDGIVVELVKPDVAVLSVEDNKGNTPLH 365

  Fly   286 IAAANGYVRVVEFLLE-QHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKDDETP 349
            ||...|.:::|..|:. :.:|::.::|...||:..:...|:.|::.:|.:.||   ...||...|
plant   366 IATNKGRIKIVRCLVSFEGINLNPINKAGDTPLDVSEKIGNAELVSVLKEAGA---ATAKDLGKP 427

  Fly   350 SDICEDPEIRERIEQLKTEQESKRLAEAQRRRVRRSQSNNTRAQSVRR 397
            .:..:  ::::.:..:|.|.:|         ::::|:....|.|.:.:
plant   428 QNPAK--QLKQTVSDIKHEVQS---------QLQQSRQTGVRVQKIAK 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYPT-75DNP_001262018.1 Ank_2 123..215 CDD:289560 23/92 (25%)
ANK repeat 123..149 CDD:293786 4/25 (16%)
ANK 146..332 CDD:238125 50/203 (25%)
ANK repeat 151..182 CDD:293786 8/31 (26%)
ANK repeat 184..215 CDD:293786 10/30 (33%)
ANK repeat 217..310 CDD:293786 25/109 (23%)
Ank_4 282..332 CDD:290365 15/50 (30%)
ANK repeat 312..343 CDD:293786 7/30 (23%)
Ank_4 314..>353 CDD:290365 10/38 (26%)
AT2G31820NP_180741.1 ANK repeat 150..186 CDD:293786 9/38 (24%)
Ank_2 155..245 CDD:403870 22/102 (22%)
ANK repeat 188..222 CDD:293786 7/33 (21%)
ANK repeat 223..254 CDD:293786 10/40 (25%)
Ank_2 228..321 CDD:403870 29/101 (29%)
ANK repeat 256..289 CDD:293786 13/41 (32%)
ANK repeat 291..323 CDD:293786 8/31 (26%)
Ank_2 296..388 CDD:403870 21/91 (23%)
ANK repeat 325..357 CDD:293786 5/31 (16%)
ANK repeat 359..391 CDD:293786 10/31 (32%)
PHA02736 <360..418 CDD:165103 16/57 (28%)
PGG 473..585 CDD:404788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24186
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.