DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment MYPT-75D and Ppp1r27

DIOPT Version :9

Sequence 1:	NP_001262018.1	Gene:	MYPT-75D / 40032	FlyBaseID:	FBgn0036801	Length:	741	Species:	Drosophila melanogaster
Sequence 2:	NP_081090.1	Gene:	Ppp1r27 / 68701	MGIID:	1915951	Length:	154	Species:	Mus musculus

Alignment Length:	125	Identity:	45/125 - (36%)
Similarity:	75/125 - (60%)	Gaps:	4/125 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   113 RHISFENSVVLLEAASRNDMPEVAALLQ-HGITPDAANEDGLTAMHQACIDNNVEMLQLLLEYGA 176
            |.:.|.|.|:.|:...:.|:.:|...:: ..::.|..:..||.|:|:|.:..|:|.::||::|||
Mouse    24 RSVRFPNDVLFLDHIRQGDLEQVGRFIRARKVSLDTIHPSGLAALHEAVLSGNLECVKLLVKYGA 88

  Fly   177 NVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCD-DEKTLDFIE 235
            ::..:|...|||||.|.:.|:.::.|.||..||:..|.|.||::|.||.| |.|  |.:|
Mouse    89 DIHQRDETGWTPLHIACSDGYPDIARYLISLGADRDAANDDGDLPSDLIDPDFK--DLVE 146

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
MYPT-75D	NP_001262018.1	Ank_2	123..215	CDD:289560	30/92 (33%)
		ANK repeat	123..149	CDD:293786	4/26 (15%)
		ANK	146..332	CDD:238125	38/91 (42%)
		ANK repeat	151..182	CDD:293786	12/30 (40%)
		ANK repeat	184..215	CDD:293786	13/30 (43%)
		ANK repeat	217..310	CDD:293786	10/20 (50%)
		Ank_4	282..332	CDD:290365
		ANK repeat	312..343	CDD:293786
		Ank_4	314..>353	CDD:290365
Ppp1r27	NP_081090.1	ANK	38..147	CDD:238125	40/111 (36%)
		Ank_2	38..127	CDD:289560	29/88 (33%)
		ANK repeat	63..94	CDD:293786	12/30 (40%)
		ANK 1	63..92		12/28 (43%)
		ANK repeat	96..127	CDD:293786	13/30 (43%)
		ANK 2	96..125		12/28 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0505
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810