DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment MYPT-75D and nrarpb

DIOPT Version :9

Sequence 1:	NP_001262018.1	Gene:	MYPT-75D / 40032	FlyBaseID:	FBgn0036801	Length:	741	Species:	Drosophila melanogaster
Sequence 2:	NP_852473.1	Gene:	nrarpb / 353225	ZFINID:	ZDB-GENE-030515-7	Length:	111	Species:	Danio rerio

Alignment Length:	102	Identity:	34/102 - (33%)
Similarity:	57/102 - (55%)	Gaps:	11/102 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   108 TLSGRRHISFENSVVLLEAASRNDMPEVAALLQH----GITPDAANEDGLTAMHQACIDNNVEML 168
            |.|.|:.       |..||..:.:..|:.:|||:    ....::...:|.||:||:.||.|:|::
Zfish     7 TCSARQR-------VFQEALRKGNTKELHSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELV 64

  Fly   169 QLLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILI 205
            :||:::||:....:.|.|:.||.||..||.::|..||
Zfish    65 KLLVKFGADTRLANRDGWSALHIAAFGGHQDIVLYLI 101

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
MYPT-75D	NP_001262018.1	Ank_2	123..215	CDD:289560	30/87 (34%)
		ANK repeat	123..149	CDD:293786	6/29 (21%)
		ANK	146..332	CDD:238125	24/60 (40%)
		ANK repeat	151..182	CDD:293786	13/30 (43%)
		ANK repeat	184..215	CDD:293786	11/22 (50%)
		ANK repeat	217..310	CDD:293786
		Ank_4	282..332	CDD:290365
		ANK repeat	312..343	CDD:293786
		Ank_4	314..>353	CDD:290365
nrarpb	NP_852473.1	Ank_4	13..68	CDD:290365	17/61 (28%)
		ANK	18..>101	CDD:238125	27/82 (33%)
		ANK repeat	47..78	CDD:293786	13/30 (43%)
		ANK 1	47..76		13/28 (46%)
		Ank_4	50..101	CDD:290365	21/50 (42%)
		ANK 2	80..109		11/22 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0505
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	3	2.810