DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment MYPT-75D and nrarpa

DIOPT Version :9

Sequence 1:	NP_001262018.1	Gene:	MYPT-75D / 40032	FlyBaseID:	FBgn0036801	Length:	741	Species:	Drosophila melanogaster
Sequence 2:	NP_852472.1	Gene:	nrarpa / 353224	ZFINID:	ZDB-GENE-030515-6	Length:	112	Species:	Danio rerio

Alignment Length:	88	Identity:	30/88 - (34%)
Similarity:	54/88 - (61%)	Gaps:	4/88 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   122 VLLEAASRNDMPEVAALLQH----GITPDAANEDGLTAMHQACIDNNVEMLQLLLEYGANVDAQD 182
            |..||..:.:..|:.:|||:    ....::...:|.||:||:.||.|:|:::||:::||::...:
Zfish    15 VFQEAVKKGNTKELHSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLAN 79

  Fly   183 SDKWTPLHAAATCGHLELVRILI 205
            .:.|:.||.||..||.::|..||
Zfish    80 REGWSALHIAAFGGHQDIVLYLI 102

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
MYPT-75D	NP_001262018.1	Ank_2	123..215	CDD:289560	29/87 (33%)
		ANK repeat	123..149	CDD:293786	6/29 (21%)
		ANK	146..332	CDD:238125	23/60 (38%)
		ANK repeat	151..182	CDD:293786	13/30 (43%)
		ANK repeat	184..215	CDD:293786	10/22 (45%)
		ANK repeat	217..310	CDD:293786
		Ank_4	282..332	CDD:290365
		ANK repeat	312..343	CDD:293786
		Ank_4	314..>353	CDD:290365
nrarpa	NP_852472.1	Ank_2	19..104	CDD:372319	28/84 (33%)
		ANK repeat	48..79	CDD:293786	13/30 (43%)
		ANK 1	48..77		13/28 (46%)
		ANK 2	81..110		10/22 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.910