DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYPT-75D and SPCP1E11.10

DIOPT Version :9

Sequence 1:NP_001262018.1 Gene:MYPT-75D / 40032 FlyBaseID:FBgn0036801 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_588563.1 Gene:SPCP1E11.10 / 2538792 PomBaseID:SPCP1E11.10 Length:207 Species:Schizosaccharomyces pombe


Alignment Length:242 Identity:60/242 - (24%)
Similarity:101/242 - (41%) Gaps:55/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 TP-LHIAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKD 345
            || :.|||::|...||...|:..::.:|.|::.:||:|||..:||.::|::|.:.|.|:|:|::|
pombe     5 TPNIWIAASDGKTDVVLKHLDSGISPNAADENGYTPIHAAVSYGHSDLLKILVERGGDINIRDQD 69

  Fly   346 DETPSDICEDPEI-RERIEQLKTEQESKR---LAEAQRRRVRRSQSNNTRAQSVRR----TSLRD 402
            .|||..:||..|| .:.|.|...:...|.   |..||     ..::|....:..:.    |.|..
pombe    70 GETPLFVCEKLEIAHDLINQYNADTTVKNNDGLIAAQ-----VIEANGEFPELAKYLYSFTDLEP 129

  Fly   403 KTLTTKKDAVEETRLRLQAQEATDSEAPSSAGDPLTNGYGYGNNNGEKRPSTGSSNGQPLPHSKS 467
            |.:.|..:..:....:|..::..|.||                             ||||...|:
pombe   130 KDVNTLPNDTKIEYAKLMTEQEMDEEA-----------------------------GQPLLDQKA 165

  Fly   468 ADALDNATAALSANATHSYPSRRPPDGRENDELLRLKAAGAAGEMQR 514
            ...:|...|.            |......:|||.::.....:|..:|
pombe   166 KAEIDRILAL------------RDTGVNVDDELRKILTGALSGHFER 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYPT-75DNP_001262018.1 Ank_2 123..215 CDD:289560
ANK repeat 123..149 CDD:293786
ANK 146..332 CDD:238125 19/50 (38%)
ANK repeat 151..182 CDD:293786
ANK repeat 184..215 CDD:293786
ANK repeat 217..310 CDD:293786 10/28 (36%)
Ank_4 282..332 CDD:290365 19/50 (38%)
ANK repeat 312..343 CDD:293786 12/30 (40%)
Ank_4 314..>353 CDD:290365 17/38 (45%)
SPCP1E11.10NP_588563.1 ANK repeat 5..34 CDD:293786 10/28 (36%)
Ank_2 8..98 CDD:289560 32/89 (36%)
ANK 10..121 CDD:238125 37/115 (32%)
ANK repeat 36..67 CDD:293786 12/30 (40%)
ANK repeat 69..98 CDD:293786 10/28 (36%)
ANK repeat 100..131 CDD:293786 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto100698
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3610
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.