DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYPT-75D and Myo16

DIOPT Version :9

Sequence 1:NP_001262018.1 Gene:MYPT-75D / 40032 FlyBaseID:FBgn0036801 Length:741 Species:Drosophila melanogaster
Sequence 2:XP_008769606.1 Gene:Myo16 / 192253 RGDID:621561 Length:1934 Species:Rattus norvegicus


Alignment Length:478 Identity:122/478 - (25%)
Similarity:192/478 - (40%) Gaps:108/478 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VESLPTHERLQLARLRRAQQLKLSRQKDKEWAKLQRAKGNTASGGSGTGSLGNGLMNGNGDTTHH 99
            :||||..:|.:|.|..|.:|:|...:::|.:.|.:........|.|.....|...|..:....||
  Rat    30 LESLPLGQRQRLVRRMRCEQIKAYYEREKVFQKQEGLLKRIKPGKSQKVRFGLADMIQDAIIHHH 94

  Fly   100 FRHANGSGTLSGRRHISFENSVVLLEAASRNDMPEVAALLQHGITPDAANEDGLTAMHQACIDNN 164
            .:                                ||..||:.|..|......|.:.:|.....:|
  Rat    95 DK--------------------------------EVLQLLKEGADPHTLVSSGGSLLHLCARYDN 127

  Fly   165 VEMLQLLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDEK 229
            |.:.::|::.|.||:.||.|.|.|:|.|..|.:.::|.:||..|||:|..:.:||:|.|..    
  Rat   128 VFIAEVLIDRGVNVNHQDEDFWAPMHIACACDNPDIVLLLILAGANVLLQDVNGNIPLDYA---- 188

  Fly   230 TLDFIEGE---------MAQRGVTQELIDETRSSTERIMLRDLMELARTGGDLEEPDYQCATPLH 285
                :||.         :.:.||....:.:.:......||.|:.....:|||:.|.:....|.||
  Rat   189 ----VEGTESSAILLAYLDENGVDLNSLRQIKLQRPLSMLTDVRHFLSSGGDVNEKNDDGVTLLH 249

  Fly   286 IAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKDDETPS 350
            :|.|:||..||..|||...:::.||...|||:|.||.:|...::::|....|:.::.|.:.|.||
  Rat   250 MACASGYKEVVLLLLEHGGDLNGMDDGYWTPLHLAAKYGQTTLVKLLLAHQANPHLVNCNGEKPS 314

  Fly   351 DICEDPEIRERIEQLKTEQESKRLAEAQRRRVRRSQSNNTRAQS--------------------- 394
            ||.....|.|.:  ||.|       .|...|::.|.|..:.||.                     
  Rat   315 DIAASESIEEML--LKAE-------IAWEERMKESPSVPSLAQEELYEEILHDLPELSSKLSPLV 370

  Fly   395 ---VRRTSLRDKTLTTKKDAVEETRLRLQAQEATDSEAPSSAGDPLTNGYGYGNNNGEKRPSTGS 456
               .::.||.:|.:..|     :|...|..||:.|       |.|.|              |..|
  Rat   371 LPIAKQDSLLEKDIMFK-----DTTKGLCNQESQD-------GPPET--------------SMVS 409

  Fly   457 SNGQPLPHSKSADALDNATAALS 479
            |:.:|.....:..|..:..|.||
  Rat   410 SSSKPEQVQLTPPAPSDDLATLS 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYPT-75DNP_001262018.1 Ank_2 123..215 CDD:289560 29/91 (32%)
ANK repeat 123..149 CDD:293786 6/25 (24%)
ANK 146..332 CDD:238125 59/194 (30%)
ANK repeat 151..182 CDD:293786 8/30 (27%)
ANK repeat 184..215 CDD:293786 13/30 (43%)
ANK repeat 217..310 CDD:293786 27/101 (27%)
Ank_4 282..332 CDD:290365 21/49 (43%)
ANK repeat 312..343 CDD:293786 9/30 (30%)
Ank_4 314..>353 CDD:290365 14/38 (37%)
Myo16XP_008769606.1 ANKYR 86..332 CDD:223738 80/294 (27%)
ANK 89..190 CDD:238125 35/140 (25%)
ANK repeat 114..145 CDD:293786 8/30 (27%)
ANK 142..297 CDD:238125 51/162 (31%)
ANK repeat 147..178 CDD:293786 13/30 (43%)
ANK repeat 180..210 CDD:293786 8/37 (22%)
ANK repeat 243..274 CDD:293786 12/30 (40%)
ANK repeat 276..307 CDD:293786 9/30 (30%)
MYSc 425..1161 CDD:214580 3/8 (38%)
MYSc_Myo16 437..1154 CDD:276844
NYAP_N 1246..1603 CDD:292079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0505
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.