| Sequence 1: | NP_001262018.1 | Gene: | MYPT-75D / 40032 | FlyBaseID: | FBgn0036801 | Length: | 741 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001291885.1 | Gene: | Nfkbie / 18037 | MGIID: | 1194908 | Length: | 371 | Species: | Mus musculus |
| Alignment Length: | 341 | Identity: | 84/341 - (24%) |
|---|---|---|---|
| Similarity: | 120/341 - (35%) | Gaps: | 90/341 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 75 TASGGSGTGSLGNGLMNGNGDTTH---HFRHANGSGTLSGRRHISFENSVVLLEAASRND----- 131
Fly 132 ----MPEVAALLQHGITPDA------ANEDGLTAMHQACIDNNVEMLQLLLEYGAN--VDAQDSD 184
Fly 185 KWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNM----------------------------- 220
Fly 221 -PYDL---------CDDEKTLDFIEGEMAQRGVTQELIDETRSSTERIMLRDLMELARTGGDLE- 274
Fly 275 EPDYQCATPLHIAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADL 339
Fly 340 NVRNKDDETPSDICED 355 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| MYPT-75D | NP_001262018.1 | Ank_2 | 123..215 | CDD:289560 | 27/108 (25%) |
| ANK repeat | 123..149 | CDD:293786 | 7/40 (18%) | ||
| ANK | 146..332 | CDD:238125 | 52/233 (22%) | ||
| ANK repeat | 151..182 | CDD:293786 | 9/32 (28%) | ||
| ANK repeat | 184..215 | CDD:293786 | 9/30 (30%) | ||
| ANK repeat | 217..310 | CDD:293786 | 26/132 (20%) | ||
| Ank_4 | 282..332 | CDD:290365 | 17/49 (35%) | ||
| ANK repeat | 312..343 | CDD:293786 | 10/30 (33%) | ||
| Ank_4 | 314..>353 | CDD:290365 | 16/38 (42%) | ||
| Nfkbie | NP_001291885.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..108 | 18/74 (24%) | |
| Ank_2 | <116..188 | CDD:289560 | 20/71 (28%) | ||
| ANK | 118..254 | CDD:238125 | 32/160 (20%) | ||
| ANK repeat | 122..155 | CDD:293786 | 9/32 (28%) | ||
| ANK 1 | 122..155 | 9/32 (28%) | |||
| ANK | 152..320 | CDD:238125 | 43/192 (22%) | ||
| ANK 2 | 157..186 | 9/28 (32%) | |||
| ANK repeat | 159..188 | CDD:293786 | 9/28 (32%) | ||
| Ank_2 | 162..263 | CDD:289560 | 23/125 (18%) | ||
| ANK repeat | 190..231 | CDD:293786 | 4/40 (10%) | ||
| ANK 3 | 190..219 | 1/28 (4%) | |||
| ANK 4 | 233..262 | 11/53 (21%) | |||
| ANK repeat | 234..264 | CDD:293786 | 11/54 (20%) | ||
| Ank_2 | 238..326 | CDD:289560 | 29/112 (26%) | ||
| ANK repeat | 267..298 | CDD:293786 | 11/30 (37%) | ||
| ANK 5 | 267..296 | 9/28 (32%) | |||
| ANK | 295..>370 | CDD:238125 | 20/49 (41%) | ||
| ANK repeat | 300..334 | CDD:293786 | 11/33 (33%) | ||
| ANK 6 | 300..329 | 10/28 (36%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||