DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment MYPT-75D and ppp1r27a

DIOPT Version :9

Sequence 1:	NP_001262018.1	Gene:	MYPT-75D / 40032	FlyBaseID:	FBgn0036801	Length:	741	Species:	Drosophila melanogaster
Sequence 2:	XP_002661302.2	Gene:	ppp1r27a / 100332066	ZFINID:	ZDB-GENE-131121-348	Length:	226	Species:	Danio rerio

Alignment Length:	124	Identity:	39/124 - (31%)
Similarity:	71/124 - (57%)	Gaps:	1/124 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   106 SGTLSGRRHISFENSVVLLEAASRNDMPEVAALLQ-HGITPDAANEDGLTAMHQACIDNNVEMLQ 169
            |.||...|.:.|.|.||..:....:::.::...:: ..:..|.....|:.|:|:|.:..::|.::
Zfish    90 SVTLKPARAVRFTNDVVFQDLVRHSELEQIGRFMRARKVRLDTIFHSGMAALHEAVLSGSLECVK 154

  Fly   170 LLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDE 228
            ||::|||:|..:|.:.|||||.|.:.|:.|:.:.|:..||::.|.|.:|..|.||.|.:
Zfish   155 LLIKYGADVHQRDENGWTPLHMACSDGYPEIAKYLLSLGASVEAENENGEKPADLIDPD 213

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
MYPT-75D	NP_001262018.1	Ank_2	123..215	CDD:289560	25/92 (27%)
		ANK repeat	123..149	CDD:293786	1/26 (4%)
		ANK	146..332	CDD:238125	31/83 (37%)
		ANK repeat	151..182	CDD:293786	11/30 (37%)
		ANK repeat	184..215	CDD:293786	12/30 (40%)
		ANK repeat	217..310	CDD:293786	5/12 (42%)
		Ank_4	282..332	CDD:290365
		ANK repeat	312..343	CDD:293786
		Ank_4	314..>353	CDD:290365
ppp1r27a	XP_002661302.2	ANK	<135..218	CDD:238125	30/79 (38%)
		ANK repeat	136..167	CDD:293786	11/30 (37%)
		Ank_4	137..190	CDD:290365	20/52 (38%)
		ANK repeat	169..200	CDD:293786	12/30 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910