DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and USP3

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_006528.2 Gene:USP3 / 9960 HGNCID:12626 Length:520 Species:Homo sapiens


Alignment Length:487 Identity:145/487 - (29%)
Similarity:232/487 - (47%) Gaps:64/487 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CNCFECGSYGIQLYACLHCIYFGCRGAHITSHLRSKK-----HNVALELSHGTLYCYACRDFIYD 103
            |:...||.| :..:|..|   :......:|:|.:|:|     |.|.::.|..:.|||.|.||:  
Human    44 CSSVHCGRY-VNGHAKKH---YEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFV-- 102

  Fly   104 ARSREYALINRKLE-AKDLQKSIGWVPWVPTTKETNLLLANA--RRRLVRPN---QTIGLRGLLN 162
            ....:..|:.:..| .::|:.|    .:.....:...||.|:  ..:|::.|   ..|...||.|
Human   103 VNDTKLGLVQKVREHLQNLENS----AFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRN 163

  Fly   163 LGATCFMNCIVQALVHTPLLSDYF-------MSDRHDCGSKSSHK--------CLVCEVSRLFQE 212
            ||.|||||.|:|:|.:......||       :.:....|.::.|.        .||.|..:....
Human   164 LGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCA 228

  Fly   213 FYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSG-S 276
            .:.||::..|...|.:::|....:..||:|||||||....||.||.         |.:...:| |
Human   229 LWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHL---------ELQGGFNGVS 284

  Fly   277 GSGTNSSNS----SSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDL----- 332
            .|.....||    |:..|....:.::..||.|:||::|.|..|...|..:|||.|:|||:     
Human   285 RSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFR 349

  Fly   333 ---GETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLK 394
               .:...:|.|.  :|.|||..:|..|.|.......|..||..|:|||:|.::.||.|:..|||
Human   350 SKRSKNQENGPVC--SLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLK 412

  Fly   395 RFEHSALIDRKISSFIQFPVE-FDMTPFMSEKKNAYGD-FRFSLYAVVNHVGT-IDTGHYTAYVR 456
            ||..:|.:..|:.::::||:. .||..::.|.:|:..: ..:.|.|||.|.|: :.:||||||..
Human   413 RFHWTAYLRNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYAT 477

  Fly   457 HQKDTWVKCDDHVITMASLKQVLDSEGYLLFY 488
            |: ..|...:|..:|:...:.|:.::.|:|||
Human   478 HE-GRWFHFNDSTVTLTDEETVVKAKAYILFY 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 18/61 (30%)
Peptidase_C19D 158..489 CDD:239125 116/362 (32%)
USP3NP_006528.2 zf-UBP 29..105 CDD:307999 19/66 (29%)
UCH 159..508 CDD:306860 114/360 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929408at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.