DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and USP8

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001122082.1 Gene:USP8 / 9101 HGNCID:12631 Length:1118 Species:Homo sapiens


Alignment Length:418 Identity:125/418 - (29%)
Similarity:196/418 - (46%) Gaps:51/418 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 RSREYALINRKLEAKDLQKSI--------GWVPWV-----PT---TKETNLLLANARRRLVRPNQ 153
            |.||.:.:.|...:.|:.::|        ...|.|     ||   ..|.:.|.|:..|.|   |.
Human   706 RDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNL---NP 767

  Fly   154 TIG-----LRGLLNLGATCFMNCIVQALVHTPLLSDYF----MSDRHDCGSKSSHKCLVC-EVSR 208
            ..|     |.||.|||.||:||.|:|.|.:.|.|:|||    ..|..:..:...||..|. |...
Human   768 VFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGI 832

  Fly   209 LFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKA--KAEHESKS 271
            :.:..::|....:|.......|.......|||.|||:.|..:..:|.||....||  :..::.::
Human   833 IMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEEN 897

  Fly   272 NSSGSGSGTNSSNSSSSHC---YGQCN-CIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDL 332
            |..      .....::.|.   :.|.| .||..:|.|..:|.|.|..|:..|.|::.|..:||.|
Human   898 NDH------LDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPL 956

  Fly   333 GETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFE 397
            ..|      :..||.|||..:::.|.|....:..||.|::.::|.|:..:..||.|:..|||||.
Human   957 AST------SKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFS 1015

  Fly   398 HSALIDRKISSFIQFPVE-FDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRH-QKD 460
            :.....:|:.:.:.||:| .|::.::...||...  :::|::|.||.|.:|.||||||.:: .:.
Human  1016 YDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLK--KYNLFSVSNHYGGLDGGHYTAYCKNAARQ 1078

  Fly   461 TWVKCDDHVITMASLKQVLDSEGYLLFY 488
            .|.|.|||.::..|:..|..|..|:|||
Human  1079 RWFKFDDHEVSDISVSSVKSSAAYILFY 1106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 107/344 (31%)
USP8NP_001122082.1 USP8_dimer 8..115 CDD:312504
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..177
RHOD 199..310 CDD:197731
tolA_full 375..>547 CDD:274303
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..447
SH3-binding. /evidence=ECO:0000250 405..413
MIP-T3 474..>646 CDD:313469
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..648
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 679..746 8/39 (21%)
UCH 777..1106 CDD:306860 105/342 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.