DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and USP2

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_004196.4 Gene:USP2 / 9099 HGNCID:12618 Length:605 Species:Homo sapiens


Alignment Length:350 Identity:123/350 - (35%)
Similarity:171/350 - (48%) Gaps:35/350 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLLSDY-----FMSDRHDCGSKSSHKCLVCEVSRLFQEFYS 215
            ||.||.|||.|||||.|:|.|.:|..|.||     :|.|.|. || ::|..||.|.::|.|..::
Human   265 GLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLHH-GS-NAHTALVEEFAKLIQTIWT 327

  Fly   216 GS-RSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLH----RHCVKAKAEHESKSNSSG 275
            .| ...:|.......|..:|....||.||||.||....||.||    |..::.|:..|:..:...
Human   328 SSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDHLPD 392

  Fly   276 SGSGTNS-----SNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGET 335
            ...|...     ....|.         |..:|.|.|:|.:.|..|...||.:|||||:||.:.:.
Human   393 DEKGRQMWRKYLEREDSR---------IGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKR 448

  Fly   336 TTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSA 400
                |....||:||:..:|:.:.|....|..|..|:..:...|:||::..|.::..|||||..|.
Human   449 ----GYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESR 509

  Fly   401 LIDRKISSFIQFPV-EFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQ-KDTWV 463
            :...|:::|:.||: :.|:..|.||..|   ...::||||.||.||...||||||.|.. ...|.
Human   510 IRTSKLTTFVNFPLRDLDLREFASENTN---HAVYNLYAVSNHSGTTMGGHYTAYCRSPGTGEWH 571

  Fly   464 KCDDHVITMASLKQVLDSEGYLLFY 488
            ..:|..:|..|..||..|:.|||||
Human   572 TFNDSSVTPMSSSQVRTSDAYLLFY 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 120/347 (35%)
USP2NP_004196.4 Necessary for interaction with MDM4. /evidence=ECO:0000269|PubMed:19838211 1..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..107
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..264
UCH 266..596 CDD:278850 120/347 (35%)
Peptidase_C19R 268..597 CDD:239139 120/346 (35%)
Necessary for interaction with MDM4. /evidence=ECO:0000269|PubMed:19838211 403..503 32/112 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.