DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and USP6

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001291213.1 Gene:USP6 / 9098 HGNCID:12629 Length:1406 Species:Homo sapiens


Alignment Length:339 Identity:90/339 - (26%)
Similarity:136/339 - (40%) Gaps:81/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DLQKSIGWVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSD 184
            |.||       |||.|                    |..||.|||.|||||..:|.:.:|..|:.
Human   521 DRQK-------VPTEK--------------------GATGLSNLGNTCFMNSSIQCVSNTQPLTQ 558

  Fly   185 YFMSDRH--------DCGSKSSH--KCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAG 239
            ||:|.||        ..|.| .|  ||    ...|.||.:||::..::..:|...|..:|....|
Human   559 YFISGRHLYELNRTNPIGMK-GHMAKC----YGDLVQELWSGTQKSVAPLKLRRTIAKYAPKFDG 618

  Fly   240 YEQQDAHEFFIATLDVLHRHCVKAKAEHESK----SNSSGSGSGTNSSNSSSSHCYGQCNCIIDQ 300
            ::|||:.|.....||.||....:.   ||..    .:|.|......::.:..:|.....:.|:| 
Human   619 FQQQDSQELLAFLLDGLHEDLNRV---HEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIIVD- 679

  Fly   301 IFTGMLQSDVVCQACNGVSTTYDPF--------WDISLDLGETTTH-GGVTPKTL---IDCLERY 353
            :|.|.|:|.|.|:.|..:|..:|||        .|..:||..|... .|.||...   ::..|:|
Human   680 LFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMDLEITVIKLDGTTPVRYGLRLNMDEKY 744

  Fly   354 T------------RAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKI 406
            |            .:|.: ..|::..|..|::.:..::..|.     ||..|..|| ..:....|
Human   745 TGLKKQLRDLCGLNSEQI-LLAEVHDSNIKNFPQDNQKVQLS-----VSGFLCAFE-IPVPSSPI 802

  Fly   407 SSFIQFPVEFDMTP 420
            |:.....::|..:|
Human   803 SASSPTQIDFSSSP 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 82/301 (27%)
USP6NP_001291213.1 TBC 97..312 CDD:214540
DUF4607 <332..407 CDD:292024
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..380
UBP12 <528..1114 CDD:227847 84/325 (26%)
Peptidase_C19 533..>723 CDD:271592 61/198 (31%)
Peptidase_C19 <1023..1367 CDD:271592
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1120..1231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1384..1406
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.