DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and UBP6

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_116665.1 Gene:UBP6 / 850562 SGDID:S000001906 Length:499 Species:Saccharomyces cerevisiae


Alignment Length:440 Identity:87/440 - (19%)
Similarity:159/440 - (36%) Gaps:103/440 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 TKETNLLLANARRRL----VRPNQTIGL-----RGLLNLGATCFMNCIVQALVHTPLLSDYFMSD 189
            |.:.||:...|::..    :.|.|.:..     .|..|:|.||::|..:|||.....|.|..::.
Yeast    76 TPDANLISKPAKKNNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMILNY 140

  Fly   190 RHDCGSKSS-------HKCLVCEVSRLFQEFYSGSRS---PLSLHRLLHLIWNH--AKHLAG--Y 240
            ....|..:|       ||.:|.|:.|.|:...:.|..   |:.|...|...:..  .:...|  |
Yeast   141 NPSQGVSNSGAQDEEIHKQIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFY 205

  Fly   241 EQQDAHEFFIATLDVLHRHC------------VKAKAEHESKSNSSGSGSGTNSSNSS-SSHCYG 292
            :||||.|.|   ..:.|...            ::.|...:..:|.:......|.|:|. ..|..|
Yeast   206 KQQDAEELF---TQLFHSMSIVFGDKFSEDFRIQFKTTIKDTANDNDITVKENESDSKLQCHISG 267

  Fly   293 QCNCIIDQIFTGMLQSDVVCQACNGVSTTYDP------------------FWDISLDLGETTTHG 339
            ..|.:.:.:..|:.:.........|.::.|..                  ||..|.:........
Yeast   268 TTNFMRNGLLEGLNEKIEKRSDLTGANSIYSVEKKISRLPKFLTVQYVRFFWKRSTNKKSKILRK 332

  Fly   340 GVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQE-STKQFSLRTLPSVVSFHLKRFEHSALID 403
            .|.|..| |..:..| .|:.....|::....|..:| :.|:..::.         ::|:.|:   
Yeast   333 VVFPFQL-DVADMLT-PEYAAEKVKVRDELRKVEKEKNEKEREIKR---------RKFDPSS--- 383

  Fly   404 RKISSFIQFPVEFDMTPFM---SEKKNAYGDFR----------------FSLYAVVNHVG-TIDT 448
               |..:..|.|...|...   |||.....:::                ::|..|:.|.| ..::
Yeast   384 ---SENVMTPREQYETQVALNESEKDQWLEEYKKHFPPNLEKGENPSCVYNLIGVITHQGANSES 445

  Fly   449 GHYTAYVRHQKD--TWVKCDDHVITMASLKQVL------DSEGYLLFYHK 490
            |||.|::|.:.|  .|.|.:|..:::...:::.      :|:..|:..:|
Yeast   446 GHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSALILMYK 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 80/404 (20%)
UBP6NP_116665.1 Ubiquitin_like_fold 5..78 CDD:421700 1/1 (100%)
Peptidase_C19A 110..495 CDD:239122 80/404 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.