DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and SAD1

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_116660.1 Gene:SAD1 / 850555 SGDID:S000001901 Length:448 Species:Saccharomyces cerevisiae


Alignment Length:537 Identity:108/537 - (20%)
Similarity:180/537 - (33%) Gaps:151/537 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RHYQSYVKEHSYDTFRVID---AYFAACVNRDARERKAIHCNCFECGSYG-IQLYACLHCIYFGC 67
            ||.:..:|:.:....:..:   ||....|    ||:.........|.:.. :.:|.||.|.:: .
Yeast     8 RHSEDELKQEAVKKIKSQEPNYAYLETVV----REKLDFDSEKICCITLSPLNVYCCLVCGHY-Y 67

  Fly    68 RGAHITS----HLRSKKHNVALELSHGTLYCYACRDFIYDARSREYALINR-KLEA------KDL 121
            :|.|..|    |...:.|:|.|.|:  :|..|.....:......|..|:|. |..|      |||
Yeast    68 QGRHEKSPAFIHSIDENHHVFLNLT--SLKFYMLPQNVQILHDGEVQLLNSIKFAAYPTYCPKDL 130

  Fly   122 QKSIGWVPWVPTTKETNLLLANARRRLVRPNQTI--GLRGLLNLGATCFMNCIVQALVHTPLLSD 184
            :..                   .|:.....|:|.  |..|..|.....:.:.::..:.|...:.|
Yeast   131 EDF-------------------PRQCFDLSNRTYLNGFIGFTNAATYDYAHSVLLLISHMVPVRD 176

  Fly   185 YFMSDRHDCGSKSSHKCLVCEVS----RLFQEF--------YSGSRSPLSLHRL---LHLIWNHA 234
            :|:.:..|...:...:..:|...    :||:..        |...|..|:|:.:   |.|:|...
Yeast   177 HFLLNHFDNQGEFIKRLSICVKKIWSPKLFKHHLSVDDFVSYLKVREGLNLNPIDPRLFLLWLFN 241

  Fly   235 KHLAGYEQQDAHEFFIATLDVLHRHCVKAK---AEHESKSNSSGSGSGTNSSNSSSSHCYGQCNC 296
            |..:....          |..:..|..|.|   |:.|:|..:|.|.:|                 
Yeast   242 KICSSSND----------LKSILNHSCKGKVKIAKVENKPEASESVTG----------------- 279

  Fly   297 IIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGS 361
                                  .....|||.::|||.|.:.   ......:|.|.:.       :
Yeast   280 ----------------------KVIVKPFWVLTLDLPEFSP---FEDGNSVDDLPQI-------N 312

  Fly   362 AAKIKCSTCKSYQESTKQ-FSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEK 425
            ..|:.....||...||.. |.|..||..:.||..||:.::  |..:.:..|..|||.     ||.
Yeast   313 ITKLLTKFTKSRSSSTSTVFELTRLPQFLIFHFNRFDRNS--DHPVKNRNQTLVEFS-----SEL 370

  Fly   426 KNAYGDFRFSLYAVVNHV--------GTIDTG----HY-TAYVRHQKDTWVKCDDHVITMASLKQ 477
            :..:..:|  |.|.|.||        |....|    |: |....::.:.|::.|....|      
Yeast   371 EILHVKYR--LKANVVHVVIKQPSTDGNAFNGDEKSHWITQLYDNKSEKWIEIDGINTT------ 427

  Fly   478 VLDSEGYLLFYHKNVLE 494
              :.|..|||..:..::
Yeast   428 --EREAELLFLKETFIQ 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 15/61 (25%)
Peptidase_C19D 158..489 CDD:239125 73/362 (20%)
SAD1NP_116660.1 Peptidase_C19M 30..445 CDD:239134 105/515 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.