DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and USP30

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_016875537.1 Gene:USP30 / 84749 HGNCID:20065 Length:554 Species:Homo sapiens


Alignment Length:523 Identity:119/523 - (22%)
Similarity:176/523 - (33%) Gaps:193/523 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 WVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPL----LSDYFM 187
            :|.|.|.|:.      ..||:.:.|       ||:|||.|||||.::|.|...|.    |.::..
Human    50 YVIWGPITER------KKRRKGLVP-------GLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTS 101

  Fly   188 SDRHDCGSKSSHKCLVCEVSRLF-----QEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHE 247
            ....|.....||:.|...:..|.     ||....  ..|....||.::..:...::.:|:|||||
Human   102 QYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDD--EVLDASCLLDVLRMYRWQISSFEEQDAHE 164

  Fly   248 FF---IATLD--------VLHR---HCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCII 298
            .|   .::|:        |.|.   |.::.::|...|..:..:   ..|.:.:|:|...|     
Human   165 LFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRT---RGSPHPTSNHWKSQ----- 221

  Fly   299 DQIFTGMLQSDVVCQACNGVS-TTYDPFWDISLDL-GETTTHGGVTPKTLIDCLERYTRAEHLGS 361
             ..|.|.|.|::||:.|...| ..:|.|..:||.: ..|..|    |.||..||..:..:|   |
Human   222 -HPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGH----PLTLDHCLHHFISSE---S 278

  Fly   362 AAKIKCSTCK-------------SYQEST--KQFSLRTLPSVVSFHLKRF---EHSALIDRKISS 408
            ...:.|..|.             .:|.:|  ||..|..||..:..||:|.   .|...:.|  ..
Human   279 VRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKR--HE 341

  Fly   409 FIQFPVEFDM-------------------------------------TP------------FMSE 424
            .:||. ||.|                                     ||            |.:|
Human   342 HVQFN-EFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPGVCARGADAAGIFSTE 405

  Fly   425 KKN------------AYG----------------------------------------------D 431
            |.:            |.|                                              .
Human   406 KSSLASPPSGSLMTGAQGLYNVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST 470

  Fly   432 FRFSLYAVVNHVGTIDTGHYTAYVR---------HQKDTWVKCDDHVITMASLKQVLDSEGYLLF 487
            :.|.|.|||.|.|.:.:||:..|.|         ...:.|:...|..:..|||::||.|..||||
Human   471 YLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLF 535

  Fly   488 YHK 490
            |.:
Human   536 YER 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 111/489 (23%)
USP30XP_016875537.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.