DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and USP48

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_115612.4 Gene:USP48 / 84196 HGNCID:18533 Length:1035 Species:Homo sapiens


Alignment Length:374 Identity:98/374 - (26%)
Similarity:150/374 - (40%) Gaps:92/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 WVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIV----------QALVHTP- 180
            |:..:......|:...|..||  :.|..:   ||.||||||::|..:          |||...| 
Human    63 WLGEIDENSFHNIDDPNCERR--KKNSFV---GLTNLGATCYVNTFLQVWFLNLELRQALYLCPS 122

  Fly   181 LLSDYFMSDRHDCG---SKSSHKCLVCE-VSRLFQEFYSGSR---SPLSLHRLLHLIWNHAKHLA 238
            ..|||.:.|    |   .|......:|| :..||....:.:|   .|....:.|.|...      
Human   123 TCSDYMLGD----GIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTG------ 177

  Fly   239 GYEQQDAHEF---FIATL-DVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCIID 299
              :||||.||   |::.| |.|      :|.::....|                        |:.
Human   178 --QQQDAQEFSKLFMSLLEDTL------SKQKNPDVRN------------------------IVQ 210

  Fly   300 QIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAK 364
            |.|.|......||..|...|.....|:::.|::   ..|     |.|.||:..:.:.|.|....:
Human   211 QQFCGEYAYVTVCNQCGRESKLLSKFYELELNI---QGH-----KQLTDCISEFLKEEKLEGDNR 267

  Fly   365 IKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR------KISSFIQFPVEFDMTPFMS 423
            ..|..|:|.|.:|::..|.:||..::..|.||    :.||      |::::|.|....||.|::.
Human   268 YFCENCQSKQNATRKIRLLSLPCTLNLQLMRF----VFDRQTGHKKKLNTYIGFSEILDMEPYVE 328

  Fly   424 EKKNAYGDFRFSLYAVVNHVG-TIDTGHYTAYVRH-QKDTWVKCDDHVI 470
            .|.   |.:.:.|.||:.|.| :..:|||.|:|:. |...|.|.:|..|
Human   329 HKG---GSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 92/343 (27%)
USP48NP_115612.4 UCH 89..418 CDD:278850 92/346 (27%)
Peptidase_C19L 90..419 CDD:239133 92/342 (27%)
DUSP 484..554 CDD:283896
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 612..640
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 879..919
USP48_C 929..1035 CDD:176390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.