DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and UBP2

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_563719.1 Gene:UBP2 / 839397 AraportID:AT1G04860 Length:961 Species:Arabidopsis thaliana


Alignment Length:377 Identity:84/377 - (22%)
Similarity:141/377 - (37%) Gaps:84/377 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSET-GCRHYQSYVKEHSYDTFRVIDAYFAACVNRDARERKAIHCNCFECGSYGIQ--------- 55
            :.|| .|.|:     :.:.:..:|:|..      :.:|:.|...||....|..|.:         
plant    44 VKETQACVHF-----DKALNLEKVLDKI------KSSRQIKCAECNEGVYGKRGTKAKGSKGKKD 97

  Fly    56 ------------LYACLHCIYFGCRG--------AHITSHLRSKKHNVALELSHGTL-YCYACRD 99
                        ::.||.|..:.|.|        :|:..|.|..:|.:.::..:..| :|:.|:.
plant    98 FSSSDPKSNNKAIWLCLECGCYVCGGVGLPNGPQSHVLRHSRVTRHRLVIQWENPQLRWCFPCQL 162

  Fly   100 FI----------YDARSREYALIN----RKLEAKDLQKSIGWVPWVPTTKETNLLLANARRRLVR 150
            .:          .|..|....||.    ..|.:.|::........:    .:::.|..|....:.
plant   163 LLPVEKEDNGEKKDVLSEVVKLIKGRSLNNLASSDIEDQCSGSGSI----TSDIKLEGAVTSDIE 223

  Fly   151 PNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKCLVCEVSRLFQEF-- 213
            ......:|||:|||.|||.|.|:|.|:....|.|:|:.:.   ||..... |...:.:||.|.  
plant   224 ARDGYVVRGLVNLGNTCFFNSIMQNLLSLDRLRDHFLKEN---GSGVGGP-LASSLRKLFTETKP 284

  Fly   214 YSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGS 278
            .:|.:|.::.........:.|....||:|.|:||.....||.|         ..|..:.....|.
plant   285 EAGLKSVINPRAFFGSFCSKAPQFRGYDQHDSHELLRCLLDSL---------STEESALRKKRGV 340

  Fly   279 GTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISL 330
            ..|...|::         :|:.:|.|...|.|.|..|...|..|:||.|:||
plant   341 SDNDEKSTT---------LIESVFGGETSSIVSCMECGHSSKVYEPFLDLSL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 14/96 (15%)
Peptidase_C19D 158..489 CDD:239125 52/175 (30%)
UBP2NP_563719.1 zf-UBP 105..161 CDD:366940 11/55 (20%)
UBP12 <232..956 CDD:227847 51/174 (29%)
Peptidase_C19 232..>383 CDD:351799 49/172 (28%)
Peptidase_C19K <703..955 CDD:239132
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.