DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and UBP15

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001185019.1 Gene:UBP15 / 838281 AraportID:AT1G17110 Length:928 Species:Arabidopsis thaliana


Alignment Length:342 Identity:98/342 - (28%)
Similarity:163/342 - (47%) Gaps:43/342 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 RGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKCLVCEVSR---LFQEFYSGSRS 219
            |||:|.|.:|:.|.::|:|..|..|..|.:...|.........||:||:.:   :.:|    |..
plant   442 RGLVNCGNSCYANAVLQSLTCTKPLVAYLLRRSHSRSCSGKDWCLMCELEQHVMMLRE----SGG 502

  Fly   220 PLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSN 284
            |||..|:|..:.:....:....|:|||||....:..:...|:: :...|:|.:..          
plant   503 PLSASRILSHMRSINCQIGDGSQEDAHEFLRLLVASMQSICLE-RLGGETKVDPR---------- 556

  Fly   285 SSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDC 349
                   .|...::..:|.|.|:|.|.|..|:..|..|:...|::|::     :|.|  ::|.|.
plant   557 -------LQETTLVQHMFGGRLRSKVKCLRCDHESERYENIMDLTLEI-----YGWV--ESLQDA 607

  Fly   350 LERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPV 414
            |.::||.|.|......:||.|..|..:.|:.|:...|::::..||||:....  .||:..|.||.
plant   608 LTQFTRPEDLDGENMYRCSRCAGYVRARKELSIHEAPNILTIVLKRFQEGRY--GKINKCISFPE 670

  Fly   415 EFDMTPFMSEKKNAYGDF--RFSLYAVVNHVGTID---TGHYTAYVRHQKDTWVKCDDHVITMAS 474
            ..||.|||:..    ||.  .:.||||:.|:.|::   :|||.:||:..:..|.:.||..|....
plant   671 MLDMIPFMTRT----GDVPPLYMLYAVIVHLDTLNASFSGHYISYVKDLRGNWYRIDDSEIHPVP 731

  Fly   475 LKQVLDSEGYLLFYHKN 491
            :.||:....|:|||.::
plant   732 MTQVMSEGAYMLFYMRS 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 97/338 (29%)
UBP15NP_001185019.1 zf-MYND 130..167 CDD:280009
Peptidase_C19E 441..746 CDD:239126 97/338 (29%)
UCH 441..745 CDD:278850 96/337 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.