DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and UBP12

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_568171.1 Gene:UBP12 / 830548 AraportID:AT5G06600 Length:1116 Species:Arabidopsis thaliana


Alignment Length:344 Identity:85/344 - (24%)
Similarity:136/344 - (39%) Gaps:69/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLL--SDYFM-SDRHDCGSKSSHKCLVCEVSRLFQEFYSGS 217
            |..||.|.||||:||.::|.|.|.|..  :.|.| :..:|..:.|                    
plant   197 GFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDAPTAS-------------------- 241

  Fly   218 RSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVK-------AKAEHESKSNSSG 275
             .||:|..|.:.:..:...:|..|.  ...|...|.|...:|.|:       .|.|.:.|     
plant   242 -IPLALQSLFYKLQYNDTSVATKEL--TKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMK----- 298

  Fly   276 SGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGG 340
               ||....:            |.|:|.|...:.:.|...:..||..:.|:|:.||:...     
plant   299 ---GTVVEGT------------IQQLFEGHHMNYIECINVDFKSTRKESFYDLQLDVKGC----- 343

  Fly   341 VTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR- 404
               |.:....::|...|.|....|..... ...|::.|.......|.|:...|||||:..:.|. 
plant   344 ---KDVYASFDKYVEVERLEGDNKYHAEG-HGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTM 404

  Fly   405 -KISSFIQFPVEFDMT----PFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQ-KDTWV 463
             ||:...:||:|.|:.    .::|...:......::|::|:.|.|.:..|||.|::|.. .|.|.
plant   405 VKINDRYEFPLELDLDREDGKYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWY 469

  Fly   464 KCDDHVITMASLKQVLDSE 482
            |.||..:|...||:.|:.:
plant   470 KFDDERVTKEDLKRALEEQ 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 84/342 (25%)
UBP12NP_568171.1 MATH 55..179 CDD:238068
COG5077 57..1114 CDD:227409 85/344 (25%)
peptidase_C19C 197..526 CDD:239124 85/344 (25%)
USP7_ICP0_bdg 625..875 CDD:289221
USP7_C2 884..1095 CDD:291217
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.