DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and UBP3

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_568074.1 Gene:UBP3 / 830150 AraportID:AT4G39910 Length:371 Species:Arabidopsis thaliana


Alignment Length:368 Identity:99/368 - (26%)
Similarity:164/368 - (44%) Gaps:65/368 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 GLLNLGATCFMNCIVQALVH-TPL---LSDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSGSRS 219
            |..|.|.||:.|.::|||.. .|.   |.:|:.|::....::.:  .:.| ::.||.:..|..:.
plant    24 GFENFGNTCYCNSVLQALYFCVPFREQLLEYYTSNKSVADAEEN--LMTC-LADLFSQISSQKKK 85

  Fly   220 P--LSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATL----DVLHRHCVKAKAEHESKSNSSGSGS 278
            .  ::..|.:..:....:....|..||||||....|    |:|.:.....|.|||          
plant    86 TGVIAPKRFVQRLKKQNELFRSYMHQDAHEFLNYLLNEVVDILEKEAKATKTEHE---------- 140

  Fly   279 GTNSSNSSSSHCYG----QCNCIIDQ---------IFTGMLQSDVVCQACNGVSTTYDPFWDISL 330
             |:||:|......|    |.|.::.:         ||.|:|.::..|..|..|:...:.|.|:||
plant   141 -TSSSSSPEKIANGLKVPQANGVVHKEPIVTWVHNIFQGILTNETRCLRCETVTARDETFLDLSL 204

  Fly   331 DLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKR 395
            |:.:.:        ::..||:.::..|.|.:..|..|..|.|.||:.|:..::..|.::..||||
plant   205 DIEQNS--------SITSCLKNFSSTETLHAEDKFFCDKCCSLQEAQKRMKIKKPPHILVIHLKR 261

  Fly   396 FEHSALIDR--KISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGT-IDTGHYTAYVRH 457
            |::...:.|  |:|..:.||:|..    :|.....|.|..:||:|||.|||: .:.|||.:.|: 
plant   262 FKYIEQLGRYKKLSYRVVFPLELK----LSNTVEPYADVEYSLFAVVVHVGSGPNHGHYVSLVK- 321

  Fly   458 QKDTWVKCDDHVITMASLKQVL------------DSEGYLLFY 488
            ..:.|:..||..:.|.....|.            ...||:|||
plant   322 SHNHWLFFDDENVEMIEESAVQTFFGSSQEYSSNTDHGYILFY 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 99/368 (27%)
UBP3NP_568074.1 Peptidase_C19G 24..365 CDD:239128 99/368 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.