DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and UBP13

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001326292.1 Gene:UBP13 / 820364 AraportID:AT3G11910 Length:1115 Species:Arabidopsis thaliana


Alignment Length:349 Identity:84/349 - (24%)
Similarity:137/349 - (39%) Gaps:79/349 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLL--SDYFM-SDRHDCGSKSSHKCLVCEVSRLFQEFYSGS 217
            |..||.|.||||:||.::|.|.|.|..  :.|.| :..:|..:.|                    
plant   196 GFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDAPTAS-------------------- 240

  Fly   218 RSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVK-------AKAEHESKSNSSG 275
             .||:|..|.:.:..:...:|..|.  ...|...|.|...:|.|:       .|.|.:.|     
plant   241 -IPLALQSLFYKLQYNDTSVATKEL--TKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMK----- 297

  Fly   276 SGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGG 340
               ||....:            |.::|.|...:.:.|...:..||..:.|:|:.||:...     
plant   298 ---GTVVEGT------------IQKLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGC----- 342

  Fly   341 VTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR- 404
               |.:....::|...|.|....|..... ...|::.|.......|.|:...|||||:..:.|. 
plant   343 ---KDVYASFDKYVEVERLEGDNKYHAEG-HDLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTM 403

  Fly   405 -KISSFIQFPVEFD--------MTPFMSEK-KNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQ- 458
             ||:...:||::.|        ::|...:. :|.|     :|::|:.|.|.:..|||.|::|.. 
plant   404 VKINDRYEFPLQLDLDREDGRYLSPDADKSVRNLY-----TLHSVLVHSGGVHGGHYYAFIRPTL 463

  Fly   459 KDTWVKCDDHVITMASLKQVLDSE 482
            .|.|.|.||..:|...:|:.|:.:
plant   464 SDQWYKFDDERVTKEDVKRALEEQ 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 83/347 (24%)
UBP13NP_001326292.1 COG5077 46..1113 CDD:227409 84/349 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.