DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and si:ch211-212k18.13

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_009301371.1 Gene:si:ch211-212k18.13 / 794291 ZFINID:ZDB-GENE-160728-93 Length:519 Species:Danio rerio


Alignment Length:350 Identity:73/350 - (20%)
Similarity:130/350 - (37%) Gaps:88/350 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 GLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSGSRSPLSL 223
            ||.|.||||::|.::|.|..|....:..:..|.:...:..:  ::.::.|||::......:...:
Zfish    18 GLTNQGATCYLNAVLQCLFMTEEFREEVLRYRSEDSLEKEN--ILVQLQRLFRKLSKTVTTTEGV 80

  Fly   224 HRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSS 288
            .|.|.:     :::  :|||||.|::...|..:.....|                          
Zfish    81 TRSLGI-----RNV--FEQQDAVEYYRKILKTMGPLAFK-------------------------- 112

  Fly   289 HCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERY 353
                        :|.|.:.:...|..|             ..::.||.|...:.....::..:.|
Zfish   113 ------------VFEGKMINITKCGKC-------------GKEMPETNTFISILLSINVENNKMY 152

  Fly   354 -------TRAEH--LGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSF 409
                   |..||  |.....:.|..|....::.....:...|:|::.|||||:.         .:
Zfish   153 DVETGLKTFEEHSILDEDDWVYCDECDCKTKTETWTKIDEYPNVLTLHLKRFDF---------DY 208

  Fly   410 IQFPVE-----FDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVR-HQKDTWVKCDDH 468
            :|...|     .|:...:.:|.|...   :.||||:||.|....|||.|.:: ::...|...||.
Zfish   209 MQMRYEKNECRLDVPLTLPKKDNRPS---YELYAVINHKGRYSGGHYEAIIKSYENGVWYCFDDS 270

  Fly   469 VITMASLKQVLDSE-GYLLFYHKNV 492
            .:|..|...:.:|. .|:|.|.|.|
Zfish   271 RVTETSETPLKNSSLPYMLLYRKKV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 70/345 (20%)
si:ch211-212k18.13XP_009301371.1 UCH 18..291 CDD:306860 70/344 (20%)
P-loop_NTPase 305..478 CDD:328724
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.