DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and USP7

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_016879141.1 Gene:USP7 / 7874 HGNCID:12630 Length:1113 Species:Homo sapiens


Alignment Length:358 Identity:88/358 - (24%)
Similarity:140/358 - (39%) Gaps:76/358 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLL--SDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSGSR 218
            |..||.|.||||:||.::|.|..|..|  :.|.|....|..|||    :...:.|:|.|. ..|.
Human   212 GYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKS----VPLALQRVFYEL-QHSD 271

  Fly   219 SPLSLHRLLHLI-WNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNS 282
            .|:...:|.... |   :.|..:.|.|..|.....||         ..|::.|        ||  
Human   272 KPVGTKKLTKSFGW---ETLDSFMQHDVQELCRVLLD---------NVENKMK--------GT-- 314

  Fly   283 SNSSSSHCYGQCNCI---IDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDL-GETTTHGGVTP 343
                         |:   |.::|.|.:.|.:.|:..:..|...:.::||.|.: |:         
Human   315 -------------CVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGK--------- 357

  Fly   344 KTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR--KI 406
            |.:.:....|...|.|....|..... ...||:.|.....|||.|:...|.||.:....|:  ||
Human   358 KNIFESFVDYVAVEQLDGDNKYDAGE-HGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKI 421

  Fly   407 SSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKD-TWVKCDDHVI 470
            :...:||.:..:..|: :|.:......:.|:||:.|.|....|||..|:..:.| .|.|.||.|:
Human   422 NDRFEFPEQLPLDEFL-QKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVV 485

  Fly   471 TMASLKQVLD---------------SEGYLLFY 488
            :..:.::.::               :..|:|.|
Human   486 SRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVY 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 87/356 (24%)
USP7XP_016879141.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.