DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and USP17L30

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001243796.1 Gene:USP17L30 / 728419 HGNCID:44458 Length:530 Species:Homo sapiens


Alignment Length:366 Identity:109/366 - (29%)
Similarity:175/366 - (47%) Gaps:66/366 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LANARRRLVRPNQTIGL---------RGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSK 196
            ||...|:|. |.:.:.|         .||.|:|.||::|..:|.|.:||.|::|.:|..|   |:
Human    55 LAPVARQLA-PREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREH---SQ 115

  Fly   197 SSHK---CLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGY---EQQDAHEFFIATLDV 255
            :.|:   |::|.:.         :....:||...|:|.......||:   :|:|||||.:.|:|.
Human   116 TCHRHKGCMLCTMQ---------AHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDA 171

  Fly   256 LHRHCVKA--KAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGV 318
            :.:.|:..  :.:|.||..:                       :|.|||.|..:|.:.|..|:|:
Human   172 MKKACLPGHKQVDHHSKDTT-----------------------LIHQIFGGYWRSQIKCLHCHGI 213

  Fly   319 STTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLR 383
            |.|:||:.||:||:        ...:::...||:..:.|.|.......|..|.....::|..:|.
Human   214 SDTFDPYLDIALDI--------QAAQSVQQALEQLVKPEELNGENAYHCGVCLQRAPASKTLTLH 270

  Fly   384 TLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVG-TID 447
            |...|:...||||  |.:...||:..:|:|...||.|:||:...  |...:.||||:.|.| :..
Human   271 TSAKVLILVLKRF--SDVTGNKIAKNVQYPECLDMQPYMSQPNT--GPLVYVLYAVLVHAGWSCH 331

  Fly   448 TGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFY 488
            .|||.:||:.|:..|.|.||..:|.:|:..||..:.|:|||
Human   332 NGHYFSYVKAQEGQWYKMDDAEVTASSITSVLSQQAYVLFY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 103/340 (30%)
USP17L30NP_001243796.1 Peptidase_C19E 79..373 CDD:239126 103/341 (30%)
UCH 80..372 CDD:278850 101/338 (30%)
HABP4_PAI-RBP1 <426..454 CDD:282609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.