DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and LOC689730

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_038952348.1 Gene:LOC689730 / 689730 RGDID:1588758 Length:541 Species:Rattus norvegicus


Alignment Length:337 Identity:94/337 - (27%)
Similarity:150/337 - (44%) Gaps:50/337 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 GLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKCLVCEV-----SRLFQEFYSGSR 218
            ||.|:|.:|::|.::|.|.|||.|:||.:|..|.........|.:|.:     ..|......|..
  Rat    51 GLQNIGNSCYLNAVLQCLTHTPPLADYMLSQEHSQRCCYPEGCKMCAMEAHVTQSLLHSHSGGVM 115

  Fly   219 SPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSS 283
            .|..:     |.....||    .|:|||||.:.||:.:|..|::...:.|           |:|.
  Rat   116 KPSEI-----LTSTFHKH----RQEDAHEFLMFTLNAMHESCLRGCKQSE-----------TSSK 160

  Fly   284 NSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLID 348
            :||          :|..||.|.::|.:.|..|.|...:||||.::.||:        .:.:::..
  Rat   161 DSS----------LIYDIFGGQMRSQIKCHHCQGTLDSYDPFLNLFLDI--------CSAQSVKQ 207

  Fly   349 CLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKR-FEHSALIDRKISSFIQF 412
            .||...:.|.|.......|..|:....::|...::|...|:...|.| ::...   .|::..:.:
  Rat   208 ALEDLVKLEELQGDNAYYCGRCREKMPASKTTKVQTASKVLLLVLNRSYDFGG---DKLNRVVSY 269

  Fly   413 PVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVG-TIDTGHYTAYVRHQKDTWVKCDDHVITMASLK 476
            |...|:.|::|:.  ..|...::||||:.|.| |..:|||..||:.....|.|.||..:|...:.
  Rat   270 PEYLDLQPYLSQP--TAGPLPYALYAVLVHDGVTCSSGHYFCYVKASHGKWYKMDDSKVTRCDVS 332

  Fly   477 QVLDSEGYLLFY 488
            .||....|||||
  Rat   333 SVLSEPAYLLFY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 94/337 (28%)
LOC689730XP_038952348.1 Peptidase_C19E 49..345 CDD:239126 94/337 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.