DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and usp21

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_005162186.1 Gene:usp21 / 563546 ZFINID:ZDB-GENE-100210-3 Length:405 Species:Danio rerio


Alignment Length:368 Identity:110/368 - (29%)
Similarity:172/368 - (46%) Gaps:36/368 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDY-----FMSDRHDCGSKSS 198
            ||:.:..|.|...|..:|||   |:|.|||:|.|||.|.||..|.||     ::.|:|    .:.
Zfish    46 LLVTDKERELQLGNGQVGLR---NVGNTCFLNAIVQCLSHTRSLRDYCLMRAYVQDKH----SNQ 103

  Fly   199 HKCLVCEVSRLFQEFY--SGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLH---- 257
            ...|:.|.|::....:  ....:.::..:...:......:.:||.||||.||....||.||    
Zfish   104 EPVLMDEFSKVLAGLWECDAGETTVNPGKFYRVFKESVPYFSGYSQQDAQEFLRFLLDRLHTEIN 168

  Fly   258 RHCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNC------IIDQIFTGMLQSDVVCQACN 316
            |...|..|..|.|..:.     |....|..:....|.:.      |:| :|:|.|:|.:.|..|:
Zfish   169 RRPSKRPAVIERKEPAY-----TRFRISEEAFAMWQRHLDRDDSKIVD-LFSGQLRSSLHCSVCS 227

  Fly   317 GVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFS 381
            ..|.|:|.|.|:||.:.:..:..| ...||.:||:.:::.|.|.......|..|....||||:.:
Zfish   228 HYSNTFDVFCDLSLPIPKQKSDYG-RAVTLRECLDLFSQEEKLDKENSPMCERCNRRTESTKRLT 291

  Fly   382 LRTLPSVVSFHLKRFEHSALIDRKISSFIQFPV-EFDMTPFMSEKKNAYGDFRFSLYAVVNHVGT 445
            ::..|.|:..||.||..|.....|.:..:.||: ..|:..|....   .|...:.||||.||.||
Zfish   292 IQRFPRVLVIHLNRFAMSRFSISKSTVPVSFPLTALDLGLFGPVD---CGPVLYDLYAVCNHSGT 353

  Fly   446 IDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFY 488
            ::.|||||..| :::.|...:|..:...|.:::..::.|:|||
Zfish   354 VNMGHYTAACR-EEEGWCFYNDSCVDAISEEKLQSNQAYVLFY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 103/349 (30%)
usp21XP_005162186.1 UCH 62..395 CDD:278850 103/350 (29%)
Peptidase_C19R 63..396 CDD:239139 105/351 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.