DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and scny

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster


Alignment Length:371 Identity:93/371 - (25%)
Similarity:166/371 - (44%) Gaps:69/371 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 RRLVRPNQTIGL------------RGLLNLGATCFMNCIVQALVHTPLLSDYFMSDR-H--DCG- 194
            :|::.|.:.|.:            .|::|:|.||::|..:|||:|.|.|:::.:|:: |  ||. 
  Fly   148 KRVLYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWLVSEQAHLADCNV 212

  Fly   195 SKSSHKCLVCEVSRLFQEFYSGSRS--PLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLH 257
            ::....|::|.:::......|...:  |..::..|..|   .||:....|:|||||....::.:.
  Fly   213 AEPGSGCIICAMTKTLLATQSNQSAVRPFLIYSKLKQI---CKHMVVGRQEDAHEFLRFLVEAME 274

  Fly   258 RHCVKAKAEHES-----KSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNG 317
            |..:.....::.     |..:.                       :.|||.|.|:|:|.|.:||.
  Fly   275 RAYLMRFRNYKELDQLVKETTP-----------------------LGQIFGGYLRSEVRCLSCNH 316

  Fly   318 VSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERY---TRAEHLGSAAKIKCSTCKSYQESTKQ 379
            ||.|:..|.|:.||:.:.        .:|.|..|.:   .|.|.:|    .||..||....:|||
  Fly   317 VSITFQHFQDLLLDIRKA--------DSLEDAFEGHFSRERLEDMG----YKCEGCKKKVSATKQ 369

  Fly   380 FSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGD-FRFSLYAVVNHV 443
            |||...|..:...||||   ::|..|::..|.|....|::.:.:..:.|... ..:.|.::|.|:
  Fly   370 FSLERAPITLCIQLKRF---SMIGNKLTKQISFKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHL 431

  Fly   444 GTID-TGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFY 488
            |... .|||||.......::...||..:...::..|.::..|::|:
  Fly   432 GASQHCGHYTAIGSTDTGSFYNFDDSYVRPIAMHSVCNTNAYIMFF 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 90/347 (26%)
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 89/346 (26%)
UCH 172..477 CDD:278850 89/345 (26%)
Asp-B-Hydro_N <617..>731 CDD:191249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.