DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and Usp10

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster


Alignment Length:446 Identity:106/446 - (23%)
Similarity:172/446 - (38%) Gaps:146/446 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQAL--------------------- 176
            |..:|||...:     :||      |||.|....|::|.|:|||                     
  Fly  1096 TRHKTNLASIS-----LRP------RGLTNRSNYCYINSILQALLGCSPFYNLLRSIPKQAAVLS 1149

  Fly   177 -VHTPLLSDY--FMS-------------DRHDCGSKSSHK------CLVCEVSRLFQEFYSGSRS 219
             |.||.::..  ||:             :..:.||:|..|      .|.|:::  |:        
  Fly  1150 EVKTPTVNAMMSFMTNFSSLPSGLRLRLNNLNKGSQSKGKDDFVGSDLQCDMA--FE-------- 1204

  Fly   220 PLSLHRLLHLIWNHAK--HLAGYEQQDAHEFFIATLDVLHRHCVKA---------------KAEH 267
            |..:::|    ||.::  |:.| .|:||.||....|:.|:...::.               .||.
  Fly  1205 PTEIYKL----WNDSREEHVEG-RQEDAEEFLGYVLNKLNDEMLEVIKLIDKPTPQQNGQEPAEP 1264

  Fly   268 ESKS-------NSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQS----------DVVCQAC 315
            |...       |:...||.|..::      :|:..  :..||.|.|:|          ||:    
  Fly  1265 EDGGDVWQMICNNRNKGSVTRQTD------FGRTP--VSDIFRGELRSRLQREGEHSTDVI---- 1317

  Fly   316 NGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHL-GSAAKIKCSTCKSYQE--ST 377
                   .||:.:.|::.:     ..:.|..::.|....:.|.: ||         |:.||  :.
  Fly  1318 -------QPFFTLQLNIEK-----AASVKEALEILVGRDQLEGVTGS---------KTKQEVVAW 1361

  Fly   378 KQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDM-TPFMSEKKNAYGDFRFSLYAVVN 441
            :|.:|..||.|:..|||.|::.:....||...:.||||..: ...:..||.:.....:.|:|||.
  Fly  1362 QQMTLEKLPVVLILHLKYFDYRSDGCTKILKKVDFPVELKIDAKILGSKKTSQKQRAYRLFAVVY 1426

  Fly   442 HVG-TIDTGHYTAYVRHQ-KDTWVKCDDHVITMASLKQVLDSE----GYLLFYHKN 491
            |.| ....|||...|.|. ..:|::.||..:...|.|.||...    .|||:|.::
  Fly  1427 HDGKEASKGHYITDVFHTGYSSWLRYDDSSVKPVSEKHVLQPHTPRVPYLLYYRRS 1482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 99/417 (24%)
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 100/423 (24%)
Peptidase_C19 1223..1480 CDD:239072 71/289 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.