DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and Usp2

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001285528.1 Gene:Usp2 / 33132 FlyBaseID:FBgn0031187 Length:950 Species:Drosophila melanogaster


Alignment Length:360 Identity:109/360 - (30%)
Similarity:173/360 - (48%) Gaps:46/360 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 RPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKS---SHKCLVCEVSRLFQ 211
            |..::.||.||.|:|.|||||.::|.|.||..|: .|:...|  ||:|   ..:.::.|.::|.|
  Fly   617 RDEKSEGLCGLRNIGNTCFMNSVIQCLSHTQELT-RFLRSHH--GSRSLSTKDQQILHEFAKLIQ 678

  Fly   212 EFYSG---SRSPLSLHRLLHLIWNHAKH--LAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKS 271
            |.::.   :.:|:.|.|..     ..||  .:.|.||||.||....||.||           |..
  Fly   679 EMWTANVHTVTPMELKRAF-----STKHRMYSDYNQQDAQEFLRFFLDSLH-----------SAL 727

  Fly   272 NSSGSGSGTNSSNSSSSHCYGQC---------NCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWD 327
            ||...|...|..::.|.:.....         |.::..:|.|.|:|.:.|..|...|.|:|||||
  Fly   728 NSGVKGETLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWD 792

  Fly   328 ISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFH 392
            :|:.|..::.      ..|..||:.:.|.|.|.......|:.||:.::.||.|:::..|..:..|
  Fly   793 LSVPLPSSSR------CKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIH 851

  Fly   393 LKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRH 457
            ||||..:..  .|:|:.::||.........|...|:..:..:||||:.||:|:...|||.|..:|
  Fly   852 LKRFSETRW--SKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKH 914

  Fly   458 Q-KDTWVKCDDHVITMA-SLKQVLDSEGYLLFYHK 490
            . ...|.:.:|::::.| |...::.|..|:|||.:
  Fly   915 PVSRKWHEFNDNIVSDALSENHLVSSSAYILFYER 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 105/349 (30%)
Usp2NP_001285528.1 UCH 624..947 CDD:278850 105/349 (30%)
Peptidase_C19R 626..948 CDD:239139 105/348 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21646
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.