DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and HDAC6

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster


Alignment Length:216 Identity:50/216 - (23%)
Similarity:77/216 - (35%) Gaps:71/216 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CFECGSYGIQLYACLHCIYFGCR---GAHITSHLRSKKHNVALELSHGTLYCYACRDFIYDARSR 107
            |..|||.| :.:.||.|.:..|.   .||:..|...::|.:|:..:..:::||||..::  ...|
  Fly  1007 CSVCGSTG-ENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYV--DHPR 1068

  Fly   108 EYALINRKLEAKDLQKSIGWV---PW--------VPTTKE----------TNLLLANARRRLVRP 151
            .||.:|...|.| .|:.:.|.   .|        .|..::          :::.|     ||.|.
  Fly  1069 LYAYLNPLHEDK-FQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICL-----RLERN 1127

  Fly   152 NQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSG 216
            | .:.:|.|                   ..|:||.              |.:|...|....|.:.
  Fly  1128 NXPLAIRVL-------------------DALTDYL--------------CALCPPLRHLIHFLAE 1159

  Fly   217 SRSPLSLHR----LLHLIWNH 233
            ...|| |.|    |||....|
  Fly  1160 HLWPL-LERIYLNLLHYFLAH 1179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 18/59 (31%)
Peptidase_C19D 158..489 CDD:239125 17/80 (21%)
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527
zf-UBP 1007..1069 CDD:280334 18/64 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.