DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and Usp7

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_572779.2 Gene:Usp7 / 32169 FlyBaseID:FBgn0030366 Length:1129 Species:Drosophila melanogaster


Alignment Length:412 Identity:102/412 - (24%)
Similarity:166/412 - (40%) Gaps:74/412 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 IYDARSREYALIN--RKLEAKDLQKSIGWVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNL 163
            ::.::..:|...|  ...|.||.:||  :|.....|.|.:::.......|....:..|..||.|.
  Fly   184 LFYSKENDYGYSNFITWQELKDSEKS--YVHNNSITLEVHVVADAPHGVLWDSKKHTGYVGLKNQ 246

  Fly   164 GATCFMNCIVQALVHTP--LLSDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSGSRSPLSLHRL 226
            ||||:||.::|.|..|.  .||.|.:....|..|||    :...:.|:|.|...|.| |:...:|
  Fly   247 GATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKS----VGLSLQRVFHELQFGDR-PVGTKKL 306

  Fly   227 LHLI-WNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSSHC 290
            .... |   :.|..:.|.|..||....||.|           |||.      .||....:     
  Fly   307 TKSFGW---ETLDSFMQHDVQEFLRVLLDKL-----------ESKM------KGTILEGT----- 346

  Fly   291 YGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTR 355
                   |..:|.|.:.|.:.|:..:..||.|:.|:||.|::.:        .|.:.:..:.|..
  Fly   347 -------IPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKD--------KKNIYESFQDYVA 396

  Fly   356 AEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR--KISSFIQFPVEFDM 418
            .|.|....|..... ...||::|.....:.|.|:..||.||::..:.|.  |.:...:|....::
  Fly   397 PETLEGDNKYDAGV-HGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINL 460

  Fly   419 TPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKD-TWVKCDDHVITMASLKQVLD-- 480
            ..:::|.:|...|  :.|:||:.|.|....|||..::..:.| .|.|.||.|::....::.::  
  Fly   461 DRYLAESENTLAD--YVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQN 523

  Fly   481 --------------SEGYLLFY 488
                          |..|:|.|
  Fly   524 YGGMDDEISFHAKCSNAYMLVY 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 0/1 (0%)
Peptidase_C19D 158..489 CDD:239125 90/353 (25%)
Usp7NP_572779.2 MATH_HAUSP 100..229 CDD:239741 10/46 (22%)
COG5077 101..1119 CDD:227409 102/412 (25%)
peptidase_C19C 239..549 CDD:239124 91/355 (26%)
USP7_ICP0_bdg 647..886 CDD:289221
USP7_C2 897..1113 CDD:291217
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.