DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and Usp36

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_038942129.1 Gene:Usp36 / 303700 RGDID:1309937 Length:1098 Species:Rattus norvegicus


Alignment Length:417 Identity:119/417 - (28%)
Similarity:203/417 - (48%) Gaps:65/417 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ACRDFIYDARS--REYALINRKLEAKDLQKSIGWVPWV--PTTKETNLLLAN---ARRRLVRPNQ 153
            |.:.|.|...|  .:|.|:|.|.|.....:| |..|..  |.|:..:....:   |.::::.|.:
  Rat    45 ASKSFSYQLESLKSKYVLLNPKAEGAGRHRS-GDEPQARKPGTERMSGSGGDGVPAPQKVLFPVE 108

  Fly   154 TIGLR---------GLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHK---CLVCEV 206
            .:.||         ||.|||.|||:|..:|.|.:||.|::|.:|..|   ::|.|:   |::|.:
  Rat   109 RLSLRWERVFRVGAGLHNLGNTCFLNSTIQCLTYTPPLANYLLSKEH---ARSCHQGSFCMLCVM 170

  Fly   207 -SRLFQEFYSGSRS--PLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHE 268
             :.:.|.|.:...:  |:|..|.|..|   |:|.....|:|||||...|:|.:.:.|:...|:.:
  Rat   171 QNHMVQAFANSGNAIKPVSFIRDLKKI---ARHFRFGNQEDAHEFLRYTIDAMQKACLNGYAKLD 232

  Fly   269 SKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLG 333
            .::                     |...::.|||.|.|:|.|.|..|..||.||||:.||:|::.
  Rat   233 RQT---------------------QATTLVHQIFGGYLRSRVKCSVCRSVSDTYDPYLDIALEIR 276

  Fly   334 ETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEH 398
            :..        .::..||.:.:::.|.......|:.||....::|:||:....:|::..||||.:
  Rat   277 QAA--------NIVRALELFVKSDVLSGENAYMCAKCKKKVPASKRFSIHRTSNVLTLSLKRFAN 333

  Fly   399 SALIDRKISSFIQFPVEFDMTPFMSEKKNAYGD-FRFSLYAVVNHVG-TIDTGHYTAYVRHQKDT 461
            .:  ..||:..:.:|...::.|:||:..   || ..:.||||:.|.| :...|||..||:.....
  Rat   334 FS--GGKITKDVGYPEFLNIRPYMSQSS---GDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQ 393

  Fly   462 WVKCDDHVITMASLKQVLDSEGYLLFY 488
            |.:.:|.::..:::|.||..:.|:|||
  Rat   394 WYQMNDSLVHSSNVKVVLSQQAYVLFY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 2/6 (33%)
Peptidase_C19D 158..489 CDD:239125 102/348 (29%)
Usp36XP_038942129.1 Peptidase_C19E 121..421 CDD:239126 101/340 (30%)
Herpes_BLLF1 <493..>807 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929408at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.