DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and Usp5

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001100089.1 Gene:Usp5 / 297593 RGDID:1308438 Length:858 Species:Rattus norvegicus


Alignment Length:427 Identity:84/427 - (19%)
Similarity:150/427 - (35%) Gaps:120/427 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YFGCRGA--HITSHLRSKKHNVALELSHGTL-------YCYACRDFIYDARSREYALINRKLEAK 119
            ||...|.  |...|.|...:.:|::|  ||:       |.|...|.:.|....|: |.:..::..
  Rat   223 YFDGSGGNNHAVEHYRETGYPLAVKL--GTITPDGADVYSYDEDDMVLDPSLAEH-LSHFGIDML 284

  Fly   120 DLQKSIGWVPWVPTTKETNLLLANARRRL------------VRPNQTIGLRGLLNLGATCFMNCI 172
            .:||         |.|....|..:..:|:            ::|....|..|:.|||.:|::|.:
  Rat   285 KMQK---------TDKTMTELEIDMNQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSV 340

  Fly   173 VQALVHTP--------LLSDYFMS-------DRHDCGSKSSHKCLVCEVSRLFQEFYSGSRSP-- 220
            ||.|...|        .|...|.:       |.....:|..|..|..|.|:...|...|.:.|  
  Rat   341 VQVLFSIPDFQRKYVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPALESGDGEQVPEQ 405

  Fly   221 ------LSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSG 279
                  ::......||.......:...||||.|||:..::::.|:|                   
  Rat   406 KEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMVERNC------------------- 451

  Fly   280 TNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPK 344
            .:|.|.             :::|..:::..:.|.|...|..|....:.:.|.:   .....:..:
  Rat   452 RSSENP-------------NEVFRFLVEEKIKCLATEKVKYTQRVDYIMQLPV---PMDAALNKE 500

  Fly   345 TLIDCLERYTRAEHLGSA------AKIKCSTC--------------------KSYQESTKQFSLR 383
            .|::..|:..:||....|      |::..|:|                    ||....|.:|:  
  Rat   501 ELLEYEEKKRQAEEEKVALPELVRAQVPFSSCLEAYGAPEQVDDFWSTALQAKSVAVKTTRFA-- 563

  Fly   384 TLPSVVSFHLKRFEHSA-LIDRKISSFIQFPVEFDMT 419
            :.|..:...:|:|.... .:.:|:...|:.|.|.|::
  Rat   564 SFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 13/47 (28%)
Peptidase_C19D 158..489 CDD:239125 60/312 (19%)
Usp5NP_001100089.1 UBP14 18..855 CDD:227532 84/427 (20%)
zf-UBP 199..272 CDD:280334 14/50 (28%)
Peptidase_C19B 327..854 CDD:239123 60/311 (19%)
UBA1_UBP5 655..702 CDD:270566
UBA2_UBP5 723..765 CDD:270569
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.