DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and ubp4

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001342719.1 Gene:ubp4 / 2540837 PomBaseID:SPBC18H10.08c Length:593 Species:Schizosaccharomyces pombe


Alignment Length:492 Identity:105/492 - (21%)
Similarity:189/492 - (38%) Gaps:129/492 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KHNVALELS-------------------HGTL-YCYACRDFIYDARSREYALINR----KLE--- 117
            ||.:|:.:|                   |.:: .||:...:..|. |..|.|.:.    ||:   
pombe   143 KHTIAIPISCLQSMDSSKIYDFLKSAPFHPSMVICYSLERYFEDV-SLAYKLYSMLRSLKLDPHF 206

  Fly   118 -----AKDLQKSIGWVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQAL- 176
                 .|.:..|:.:..:.|.                         ||.|||.||:|||::|.| 
pombe   207 MELANPKKVDSSLSYENYQPI-------------------------GLTNLGNTCYMNCVLQCLF 246

  Fly   177 ----VHTPLLSD----YFMSDRHDCGSKSSHKCLVCEVSRLFQEFYS---------GSRSPLSLH 224
                :..|:|..    ..::.::..|:.          .::...|:|         |.|| :|..
pombe   247 ACKDLTIPMLQGRGLLQNINTKNPLGTG----------GKITSAFFSLLQSVLLNHGQRS-ISPR 300

  Fly   225 RLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSS- 288
            ..|.::.:..:..:...|.||.||....||.||         .:..||:|.|.....:.:..|: 
pombe   301 NFLEIVQSLNRDFSIDGQCDAQEFLNFFLDKLH---------EDLNSNASRSPIAPLTEDQLSAR 356

  Fly   289 ---------------HCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTH 338
                           |.....:.:::. |.|.|.|...|..|...|||:.||..:::.: :..:|
pombe   357 EELPLSHFSHIEWNLHLRSNKSIVVNN-FVGQLCSRTQCMTCGRTSTTFAPFTSLAIPI-DDVSH 419

  Fly   339 GGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSAL-- 401
                ..:|.:||.:::..|.|.......|..||..:.:.|...:..||..:...::||:.|.:  
pombe   420 ----VVSLQECLLKFSAPELLQGHDGWHCPVCKVQRSAKKVIMISKLPEYLIIQIQRFKISVMGR 480

  Fly   402 --IDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVK 464
              ||..:...:|.|.:. :.|...:....|....::|:|.:.|.|.::.|||.:.|....: |..
pombe   481 KKIDTPLGLSLQIPSKM-LVPPSFQSGIGYIPSNYNLFAFICHYGQLENGHYISDVLFNNE-WCH 543

  Fly   465 CDDHVI-TMASLKQVLD--SEGYLLFYHKNVL--EYE 496
            .||.:: |:..:..:.:  |..|:|||.::.|  |:|
pombe   544 IDDSIVRTVGGITDLREDFSSSYILFYKRSSLLEEFE 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 7/42 (17%)
Peptidase_C19D 158..489 CDD:239125 85/371 (23%)
ubp4NP_001342719.1 COG5533 156..574 CDD:227820 98/471 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.