DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and Usp18

DIOPT Version :10

Sequence 1:NP_001401041.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_036039.2 Gene:Usp18 / 24110 MGIID:1344364 Length:368 Species:Mus musculus


Alignment Length:271 Identity:59/271 - (21%)
Similarity:98/271 - (36%) Gaps:87/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 TPMVSAQAGTTRRRTKAPTRKELRNGSLAERTVKKEESSGDELLESTSSPDTLNKFTQNKRQSKK 177
            |.:....:|..:|||:|.     ||.:.|:    ||:..|::..||              |:.::
Mouse     2 TSLTQRNSGLVQRRTEAS-----RNAAAAD----KEKIDGEDEFES--------------RRGEE 43

  Fly   178 SCKESISNKENKDGDEPWDSKMDWKPLNFLVEV-ANGTKPLKSSAS-----QGSGSKS----EHA 232
            ..::...:||.:              |..:.|| ..|.|..:...|     ..||.:.    |.|
Mouse    44 EDEDKGDSKETR--------------LTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELA 94

  Fly   233 NVSRNQFQGSKTKTKN---KKRKCKREDDKSNNGDPTTSETVTPKRMRTTQRKRSATTLGDSRNL 294
            ...|.|.:.|..:.|:   :|..||.:   :..||....|.:  |.::.||              
Mouse    95 IRGRLQLEASGMRRKSLLTRKVLCKSD---APTGDMLLDEAL--KHVKETQ-------------- 140

  Fly   295 PQPDESSAKQERRNGPVWFSL------------VASNDQEGGTSLPQIPANFLRIRDGNT---TV 344
             .|:...:..|..:|..|..|            :|.|..|.|. |.....||| :.|..|   |.
Mouse   141 -PPETVQSWVELLSGETWNPLKLHYQLRNVRERLAKNLVEKGV-LTTEKQNFL-LFDMTTHPLTN 202

  Fly   345 SFIQKYLMRKL 355
            :.:::.|:||:
Mouse   203 NTVKQRLVRKV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001401041.1 zf-UBP 253..310 CDD:460464 10/56 (18%)
Peptidase_C19D 365..696 CDD:239125
Usp18NP_036039.2 Mediates interaction with IFNAR2. /evidence=ECO:0000250|UniProtKB:Q9UMW8 31..48 4/30 (13%)
Mediates interaction with STAT2. /evidence=ECO:0000250|UniProtKB:Q9UMW8 48..109 15/74 (20%)
UCH 52..363 CDD:425685 44/198 (22%)
Mediates interaction with STAT2 and necessary for the negative regulation of the type I IFN signaling pathway. /evidence=ECO:0000250|UniProtKB:Q9UMW8 299..308
Mediates interaction with IFNAR2. /evidence=ECO:0000250|UniProtKB:Q9UMW8 309..368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.