DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and Usp32

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_011247292.1 Gene:Usp32 / 237898 MGIID:2144475 Length:1618 Species:Mus musculus


Alignment Length:513 Identity:120/513 - (23%)
Similarity:197/513 - (38%) Gaps:139/513 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YFGCRG---------AHITSHLRSKKHNVALELSHGTLYCYACRDFIYDARSREYALINRK---- 115
            |.||..         .:::..||.|:.::.|.|.:...|.....|   :....||..|..:    
Mouse   652 YTGCFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDD---EDHRLEYLKIQDEQHLV 713

  Fly   116 LEAKDLQKSIGWVPWVPTTKETNLLLANARR--RLVRPNQTIGLRGLLNLGATCFMNCIVQALVH 178
            :|.::  |.:.|       .|....:||:.:  |...|.:. |..||.|||.|||||..:|.:.:
Mouse   714 IEVRN--KDMSW-------PEEMSFIANSSKIDRHKVPTEK-GATGLSNLGNTCFMNSSIQCVSN 768

  Fly   179 TPLLSDYFMSDRH--------DCGSKSSH--KCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNH 233
            |..|:.||:|.||        ..|.| .|  ||    ...|.||.:||::..::..:|...|..:
Mouse   769 TQPLTQYFISGRHLYELNRTNPIGMK-GHMAKC----YGDLVQELWSGTQKNVAPLKLRWTIAKY 828

  Fly   234 AKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESK----SNSSGSGSGTNSSNSSSSHCYGQC 294
            |....|::|||:.|.....||.||....:.   ||..    .:|.|......::.:..:|.....
Mouse   829 APRFNGFQQQDSQELLAFLLDGLHEDLNRV---HEKPYVELKDSDGRPDWEVAAEAWDNHLRRNR 890

  Fly   295 NCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLG-ETTTH--------GGVTP-----KT 345
            :.::| :|.|.|:|.|.|:.|..:|..:|||..:||.|. ::..|        .|.||     :.
Mouse   891 SIVVD-LFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPIRYGLRL 954

  Fly   346 LIDCLERYT------------RAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFE- 397
            .:|  |:||            ::|.: ..|::..|..|::.:..::..|.     ||..|..|| 
Mouse   955 NMD--EKYTGLKKQLSDLCGLKSEQI-LFAEVHSSNIKNFPQDNQKVRLS-----VSGFLCAFEI 1011

  Fly   398 --------HSALIDRKISS--------------------FIQFPVEFDMTPFMSEKKNAYGDFRF 434
                    ..:.|....||                    ||...:...:.|..:||....|    
Mouse  1012 PIPASPVSACSPIQTDCSSSPSTNGLFTLTTNGDLPRPIFIPNGMPNTVVPCGTEKNVTNG---- 1072

  Fly   435 SLYAVVN-HVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYHKN 491
                :|| |:..:....:|.|:                :|..::::.:|.|.|...||
Mouse  1073 ----IVNGHMPPLPDDPFTGYI----------------IAVHRKMMRTELYFLSSQKN 1110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 10/47 (21%)
Peptidase_C19D 158..489 CDD:239125 96/400 (24%)
Usp32XP_011247292.1 FRQ1 189..339 CDD:227455
UBP12 518..1330 CDD:227847 120/513 (23%)
UCH <1248..1578 CDD:366104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.