DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and USP24

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_016856320.1 Gene:USP24 / 23358 HGNCID:12623 Length:2640 Species:Homo sapiens


Alignment Length:421 Identity:96/421 - (22%)
Similarity:153/421 - (36%) Gaps:114/421 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 TKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSS 198
            |||.:.|..      |....:.|..||.|.||||:||.:.|.|...|.|.:..:|...|  :.:.
Human  1691 TKEFDYLPP------VDSRSSSGFVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDD--TDNP 1747

  Fly   199 HKCLVCEVSRLFQEFYSGSRS---PLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHC 260
            ...:..:|..||.........   |.:..::..: ||  |.|...|||||:|||.:.:|.:..:.
Human  1748 DDSVFYQVQSLFGHLMESKLQYYVPENFWKIFKM-WN--KELYVREQQDAYEFFTSLIDQMDEYL 1809

  Fly   261 VKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPF 325
            .|...:.                             |....|.|:.....:|:.|.......:.|
Human  1810 KKMGRDQ-----------------------------IFKNTFQGIYSDQKICKDCPHRYEREEAF 1845

  Fly   326 WDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVS 390
              ::|:||.|:.      ::|...|:::.|.|.|..:....|..||..:.:.|:..:::||||:.
Human  1846 --MALNLGVTSC------QSLEISLDQFVRGEVLEGSNAYYCEKCKEKRITVKRTCIKSLPSVLV 1902

  Fly   391 FHLKRF----EHSALIDRKISSFIQFPVEFDMTPFM--------------------------SEK 425
            .||.||    |....|  |....|:||...:|.|:.                          |.:
Human  1903 IHLMRFGFDWESGRSI--KYDEQIRFPWMLNMEPYTVSGMARQDSSSEVGENGRSVDQGGGGSPR 1965

  Fly   426 KNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQ----KDTWVKCDDHVITMASLK-QVLDSE--- 482
            |.......:.|..|:.|.|....|||.::::.:    |..|.|.:|.||....|. :.|:.|   
Human  1966 KKVALTENYELVGVIVHSGQAHAGHYYSFIKDRRGCGKGKWYKFNDTVIEEFDLNDETLEYECFG 2030

  Fly   483 -----------------------GYLLFYHK 490
                                   .|:|||.:
Human  2031 GEYRPKVYDQTNPYTDVRRRYWNAYMLFYQR 2061

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 89/394 (23%)
USP24XP_016856320.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.