DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and AgaP_AGAP001209

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_321947.5 Gene:AgaP_AGAP001209 / 1281959 VectorBaseID:AGAP001209 Length:1958 Species:Anopheles gambiae


Alignment Length:211 Identity:65/211 - (30%)
Similarity:95/211 - (45%) Gaps:25/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKC-----LVCEVSRLFQEFYS 215
            |..||.|||.|||||..:|.|.:|..|:.||:..:|.....:|:|.     ||...:.|.::.::
Mosquito   811 GATGLHNLGNTCFMNAALQVLFNTQPLTQYFIQKKHLYELNTSNKMGTKGQLVLRYAELLRDVWT 875

  Fly   216 GSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHR--HCVKAKAEHESKSNSSGSGS 278
            .|...::..:|...:..||...:|..|.|:.|.....||.||.  :.|..|...|.| :|.|...
Mosquito   876 ASTRSIAPLKLRFCVTKHAPQFSGGGQHDSQELLDWLLDSLHEDLNRVMEKPYTELK-DSDGRSD 939

  Fly   279 GTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTP 343
            ...::.:.|.| :.:...||..:|.|.|:|.|.||.|...|..:|||..:||.|.          
Mosquito   940 VIVATEAWSQH-HARNQSIIVDLFYGQLKSKVTCQGCGRDSVRFDPFSLLSLPLP---------- 993

  Fly   344 KTLIDCLERYTRAEHL 359
                  :|.||..|.|
Mosquito   994 ------VENYTYCEVL 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 64/209 (31%)
AgaP_AGAP001209XP_321947.5 EF-hand_7 269..329 CDD:290234
EFh 272..329 CDD:238008
DUSP <558..623 CDD:283896
Peptidase_C19 814..>996 CDD:271592 59/199 (30%)
Peptidase_C19 <1587..1918 CDD:271592
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.