DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and AgaP_AGAP012248

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_320294.3 Gene:AgaP_AGAP012248 / 1280441 VectorBaseID:AGAP012248 Length:833 Species:Anopheles gambiae


Alignment Length:434 Identity:87/434 - (20%)
Similarity:150/434 - (34%) Gaps:132/434 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 HITSHLRSKKHNVALEL------SHGTLYCYACRDFIYD----------------ARSREYALIN 113
            |..:|.:...:.:|::|      ..|.:|.|:..|.:.|                ....|.::|.
Mosquito   231 HAVNHYKETNYPLAVKLGTITADGKGDVYSYSEDDMVEDPYLVKHLAHWGINVGQLEKTEKSMIE 295

  Fly   114 RKLEAKDLQKSIGWVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVH 178
            .:|   ||.:.||         |..:|..:..:  ::|....|..|:.|||.||::|.::|.|..
Mosquito   296 LEL---DLNQRIG---------EWGILCESGSQ--LKPIAGPGYTGMKNLGNTCYLNSVMQVLFT 346

  Fly   179 TP-----------LLSDYFMSD----------RHDCGSKSSHKCLVCEVSRLFQEFYSGSRSPLS 222
            .|           .:.|.|.||          :...|..|....::.|.|....:..:|..:|..
Mosquito   347 IPDFVRRFVDGSKAIFDSFPSDPANDFNVQMAKLGTGLCSGRYSVLSESSLDTADSSTGGIAPTM 411

  Fly   223 LHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSS 287
            ...   ||.......:..:||||.|||:..:..|.:|     :.|:           ||.|.:..
Mosquito   412 FKA---LIGQGHPDFSTKQQQDAQEFFLHIISTLEKH-----SRHQ-----------TNPSEALR 457

  Fly   288 SHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYD--PFWDISL--------DLGETTTHGG-- 340
            .       ||.|::           :.|:.....|:  ..|.:.|        :|.|...:..  
Mosquito   458 F-------CIEDRV-----------ECCSSGKVMYNRRDEWCLPLQIPLQKATNLDEVKQYEAER 504

  Fly   341 ---------------VTPK-TLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVV 389
                           |.|| ||..||:.:.:.|.:............:.:::||   |.::|..:
Mosquito   505 TAAEREGRRLDPDALVRPKITLAACLDTFAQPELVEQFYSTAIGAKTTAKKTTK---LASMPDYL 566

  Fly   390 SFHLKRF----EHSALIDRKISSFIQFPVEFDMTPFMSEKKNAY 429
            ..|||:|    :.::|   |:...|..|...|:.......|..|
Mosquito   567 LLHLKKFTLKEDWTSL---KLDVAIDIPEVLDLETLRGTGKQPY 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 8/37 (22%)
Peptidase_C19D 158..489 CDD:239125 67/325 (21%)
AgaP_AGAP012248XP_320294.3 UBP14 8..832 CDD:227532 87/434 (20%)
zf-UBP 198..272 CDD:280334 9/40 (23%)
Peptidase_C19B 327..831 CDD:239123 67/324 (21%)
UBA1_UBP5_like 626..669 CDD:270480
UBA2_UBP5 693..735 CDD:270569
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.