DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and USP18

DIOPT Version :10

Sequence 1:NP_001401041.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_059110.2 Gene:USP18 / 11274 HGNCID:12616 Length:372 Species:Homo sapiens


Alignment Length:385 Identity:81/385 - (21%)
Similarity:144/385 - (37%) Gaps:76/385 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 KETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALV----HTPLLSDYFMSDRHDCGS 402
            :::|:.....|.|....:...||.||.|:|.||.:|.::|..|    .|.:|....:..    |:
Human    32 EDSNMKREQPRERPRAWDYPHGLVGLHNIGQTCCLNSLIQVFVMNVDFTRILKRITVPR----GA 92

  Fly   403 KSSHKCLVCEVSRLFQEFYSGSRS---PLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLH 464
            ....:.:..::..|.::.....:.   ||.|...|...     ::..:.|.||.:.::...:::.
Human    93 DEQRRSVPFQMLLLLEKMQDSRQKAVRPLELAYCLQKC-----NVPLFVQHDAAQLYLKLWNLIK 152

  Fly   465 R-----HCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNG 524
            .     |.|:.                                  :..::|..::..::|..|..
Human   153 DQITDVHLVER----------------------------------LQALYTIRVKDSLICVDCAM 183

  Fly   525 VSTTYDPFWDISLDLGETTTHGGVTP-KTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFS 588
            .|:.......:.|.|.:..:    .| |||.|.|..:.:...|.|.:|..|..|.......:...
Human   184 ESSRNSSMLTLPLSLFDVDS----KPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLK 244

  Fly   589 LRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNA-----YGDFRFSLYAVVN 648
            |..||..::.||.||.......|||...:.||...|.:..:..|:.:     ....::.|:||:.
Human   245 LTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIA 309

  Fly   649 HVGTIDTGHYTAYVRHQKD-TWVKCDDHVITMASLKQVLDSEG----------YLLFYHK 697
            |||..|:|||..|:|:..| .|...:|..|.:.|.:.:..:.|          |||.|.|
Human   310 HVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQETAYLLVYMK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001401041.1 zf-UBP 253..310 CDD:460464
Peptidase_C19D 365..696 CDD:239125 74/359 (21%)
USP18NP_059110.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..45 2/12 (17%)
Mediates interaction with IFNAR2. /evidence=ECO:0000269|PubMed:28165510 36..51 2/14 (14%)
Mediates interaction with STAT2. /evidence=ECO:0000269|PubMed:28165510 51..112 15/64 (23%)
UCH 55..367 CDD:425685 74/358 (21%)
Mediates interaction with STAT2 and necessary for the negative regulation of the type I IFN signaling pathway. /evidence=ECO:0000269|PubMed:28165510 303..312 4/8 (50%)
Mediates interaction with IFNAR2. /evidence=ECO:0000269|PubMed:28165510 313..372 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.