DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and Usp9y

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_683745.2 Gene:Usp9y / 107868 MGIID:1313274 Length:2556 Species:Mus musculus


Alignment Length:450 Identity:97/450 - (21%)
Similarity:159/450 - (35%) Gaps:150/450 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLL---------------SDYFMSDRHDCGSKSS 198
            |.|....|..||.|.||||:||.::|.|...|.:               .|.|..::.|..:...
Mouse  1550 VGPRPPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNSILAIDSIWSDTDDDIFKGEKQDSENNVD 1614

  Fly   199 HKCLVCEVSRLFQEFYSGS----RSPLSLHRLLHL-------------------------IWNHA 234
            .:..|......|::..:.|    |...::..|.||                         :|...
Mouse  1615 PRDDVFRYPHQFEDKPTLSKVEDRKEYNIAVLKHLQITFGHLAASQLQYYVPKGFWQQFRLWGEP 1679

  Fly   235 KHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCIID 299
            .:|.  ||.||.|||.:.:|.|. ...||            .|..|                ::.
Mouse  1680 VNLR--EQHDALEFFNSLVDSLD-EAFKA------------LGYPT----------------VLS 1713

  Fly   300 QIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAK 364
            ::..|......:||.|.......:.|..:::|:   ..|     :.|:|.||:|.:.:.|..|..
Mouse  1714 KVLGGSFADQKICQGCPHRYECEESFTTLNVDI---RNH-----QNLLDSLEQYVKGDLLEGANA 1770

  Fly   365 IKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHS-----ALIDRKISSFIQFPVEFDMTPF--- 421
            ..|..|....::.|:..::.||||::..||||::.     |:   |.:.:.:||.|.||.|:   
Mouse  1771 YHCEKCDKKVDTVKRLLIKKLPSVLTIQLKRFDYDWERECAI---KFNDYFEFPRELDMEPYTVA 1832

  Fly   422 ------------------MSEKKNAY--GDFRFSLYAVVNHVGTIDTGHYTAYV--RHQKDT--- 461
                              .:|:..:.  |..::.|..|:.|.|..:.|||.:|:  |:.||:   
Mouse  1833 GATKLEGDSVNPQTQLIKQNEQSESVIPGSTKYRLVGVLVHSGQANGGHYYSYIIQRNGKDSKRS 1897

  Fly   462 -WVKCDDHVITMASLK----------------QVLDS--------------EGYLLFYHK 490
             |.|.||..:|...:.                :|.|.              ..|:|||.:
Mouse  1898 HWFKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYER 1957

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 93/438 (21%)
Usp9yNP_683745.2 peptidase_C19C 1557..1960 CDD:239124 95/442 (21%)
UCH 1559..1955 CDD:278850 92/437 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.