DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and usp5

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_012821494.1 Gene:usp5 / 100144735 XenbaseID:XB-GENE-995356 Length:855 Species:Xenopus tropicalis


Alignment Length:428 Identity:79/428 - (18%)
Similarity:149/428 - (34%) Gaps:119/428 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YFGCRGA--HITSHLRSKKHNVALEL-----SHGTLYCYACRDFIYDARSREYALINRKLEAKDL 121
            ||...|.  |...|.:...:.:|::|     ..|.:|.|...|.:.|....|: |.:..::...:
 Frog   222 YFDGSGGNNHALQHYQETGYPLAVKLGTITPDGGDVYSYDEDDMVLDPNLAEH-LSHFGIDMMKM 285

  Fly   122 QKSIGWVPWVPTTKETNLLLANARRRL------------VRPNQTIGLRGLLNLGATCFMNCIVQ 174
            ||         |.|....|..:..:|:            ::|....|..|:.|||.:|::|..:|
 Frog   286 QK---------TDKTMTELEIDMNQRIGEWEVIQESGVQLQPLYGSGYTGIQNLGNSCYLNSTMQ 341

  Fly   175 ALVHTPLLSDYFMSDRHDCGSKS---SHKCLVCEVSRLFQEFYSGSRSPLSL---------HRLL 227
            .:...|.....::........||   ..:....:|::|.....||..|..::         |:.|
 Frog   342 VIFSIPAFQRKYVERMEQIFQKSPADPTQDFNTQVAKLGNGMLSGEYSKPAVEKDNDTAPEHKGL 406

  Fly   228 H----------LIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNS 282
            .          |:.......:...||||.|||:..::::.|:|                   .:|
 Frog   407 QDGIAPRMFKALVGKGHPEFSTNRQQDAQEFFLHFINMVERNC-------------------RSS 452

  Fly   283 SNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFW--------DISLDLGETTTHG 339
            ||.             :::|..:::..:.|.....|..|....:        :.:|:..|.:.:.
 Frog   453 SNP-------------NEVFRFLVEEKIKCLVSQKVKYTQRVEYILQLPVPMEAALNKDELSAYE 504

  Fly   340 GV---------TPKTLI-------DCLERYTRAEHL----GSAAKIKCSTCKSYQESTKQFSLRT 384
            ..         .|..|:       .|||.:...|.|    .:|.:.|.:..|     |.:|:  :
 Frog   505 QCRLQAEREHRPPPELVRARIPFTSCLEAFAAPEQLDEFWSAALQAKSNALK-----TSRFA--S 562

  Fly   385 LPSVVSFHLKRFEHSA-LIDRKISSFIQFPVEFDMTPF 421
            .|..:...:|:|.... .:.:|:...|..|.|.|::.|
 Frog   563 FPDYLVIQIKKFTFGLDWVPKKLDVSIDVPDELDLSEF 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 11/45 (24%)
Peptidase_C19D 158..489 CDD:239125 57/315 (18%)
usp5XP_012821494.1 UBP14 17..853 CDD:227532 79/428 (18%)
Peptidase_C19B 326..851 CDD:239123 57/314 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.