DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment not and usp20

DIOPT Version :9

Sequence 1:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_012823238.1 Gene:usp20 / 100036606 XenbaseID:XB-GENE-966528 Length:932 Species:Xenopus tropicalis


Alignment Length:652 Identity:150/652 - (23%)
Similarity:230/652 - (35%) Gaps:222/652 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CFECGSYGIQLYACLH--CIYFGCRGA---HITSHLRSKKHNVALELSHGTLYCYAC-RDFIYDA 104
            |..||..|..|:|||.  |...||..:   |.|.|.::||||:.:.|:...::|||| ::...|.
 Frog    78 CESCGVGGPNLWACLQDGCQSVGCGESYVDHSTLHAQAKKHNLTVNLTTFRVWCYACEKEVFLDP 142

  Fly   105 RSREYA-LINRKLEAKDLQKSIGWVPWVP---------TTKETNLLLANARRRLVRPNQTIGLRG 159
            |....: ..:.:|..:|...|...:..||         .:.|.:          ::|.   ||.|
 Frog   143 RGPPASQTTSPRLSHRDFPTSAHPLKSVPIAVGDDGESESDEDD----------IKPR---GLTG 194

  Fly   160 LLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGS--KSSHKCLVCE-VSRLFQEFYSGSRS-- 219
            :.|:|.:|:||..:|||.:.|.|:.:|:    :||.  ::..|..:|: ..:|..|.:...|.  
 Frog   195 MKNIGNSCYMNAALQALSNCPPLTQFFL----ECGGLVRTDKKPALCKSYQKLISELWHKKRPSY 255

  Fly   220 --PLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHR------------------------ 258
              |.||:..:.||   .....||.|||..||....:|.||.                        
 Frog   256 VVPSSLYHGIKLI---NPLFRGYSQQDTQEFLRCLMDQLHEELKEPVPLETQEREEEDRDDQREG 317

  Fly   259 ----------------------------------------------------------------- 258
                                                                             
 Frog   318 ERGGTVEEDFLSCDSGGEMGDGEGGGGVGTLSEMELLIREEVGRGLSEKEKLKERKLSYCHRRTS 382

  Fly   259 ------------------------HC-VKAKAEHESKSNSSGSGSGTNSSNSSSSHCY------- 291
                                    || .::.:.|..:|.|..|.:...||...:||.|       
 Frog   383 SEQADEDADVDTAMIPEPDNDAYVHCSSRSCSPHPVESISKHSSTPPRSSPLRTSHSYVLKKAQV 447

  Fly   292 ---------GQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISL------DLGE--TTTHG 339
                     .:...:|..||.|.:.|.|.|..|:.||||.:.|.|:||      ||.:  :|.|.
 Frog   448 LSGGKKRSEVRYRSVISDIFDGSILSLVQCLTCDRVSTTIETFQDLSLPIPGKEDLAKLHSTIHQ 512

  Fly   340 GVTPK--------------------------------------TLIDCLERYTRAEHLGSAAKIK 366
            ....|                                      ||.|||..:..|:.|.......
 Frog   513 SAVSKAGTCGDSYAAQGWLSFFMDYIRRFVVSCIPSWFWGPMITLEDCLAAFFAADELKGDNMYS 577

  Fly   367 CSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVE-FDMTPFMSEKKNAYG 430
            |..||..:...|...:..||.::..|||||.|..:...||.|.:.||:| .::.||:: |:....
 Frog   578 CERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKIGSHVSFPLEGLNLRPFLA-KECVSR 641

  Fly   431 DFRFSLYAVVNHVGTIDTGHYTAYVRHQ-KDTWVKCDDHVITMASLKQVLDSEGYLLFYHKNVLE 494
            ...:.|.||:.|.|:..:|||.:|.::. ...|.:.||..:|......|.::|.|:|||.|:..|
 Frog   642 ITTYDLLAVICHHGSASSGHYISYCQNVINGQWYEFDDQYVTEVHETVVQNAEAYVLFYRKSSEE 706

  Fly   495 YE 496
            .|
 Frog   707 AE 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
notNP_001287106.1 zf-UBP 46..103 CDD:307999 23/62 (37%)
Peptidase_C19D 158..489 CDD:239125 112/515 (22%)
usp20XP_012823238.1 UBP14 51..>311 CDD:227532 68/252 (27%)
UCH 193..700 CDD:366104 111/514 (22%)
DUSP 720..803 CDD:197831
DUSP 828..912 CDD:197831
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.