DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32199 and AT5G66060

DIOPT Version :9

Sequence 1:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:231 Identity:57/231 - (24%)
Similarity:103/231 - (44%) Gaps:57/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 LEFLSVQPMILLYHDVLYENEFKSMRDIA---MYNGSMIDGWTYVDFDKKGN-------PKQQDR 357
            :|.:|.:|...:||:.|.:.|.|.:.::|   |...:::|..|....|.:..       .:.:|:
plant    78 VEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLARGRDK 142

  Fly   358 VVKMIAFQGTTAPFTLSINRRMADMSGLEMRDNMVLYLTNYGLGGHFGKHVDYVELAKRPPDFFA 422
            .::             .|.:|::|.:.:.:.....|.:.:|.:|..:..|.||         |..
plant   143 TIR-------------EIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDY---------FMD 185

  Fly   423 DF----GGDRIATALIYASDIPLGGTTVFTKLK-------------------IAVQPKKGSALIW 464
            ::    ||.||||.|:|.||:..||.|||...|                   ::|:||.|.||::
plant   186 EYNTRNGGQRIATVLMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLF 250

  Fly   465 FNLNHAGEPDPLTEHSVCPVVLGSRWIISKW--IHE 498
            :::......||.:.|..|.|:.|::|..:||  :||
plant   251 WSMTPDATLDPSSLHGGCAVIKGNKWSSTKWLRVHE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528
P4Hc <369..497 CDD:214780 41/152 (27%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 57/231 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.