DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32199 and AT4G35820

DIOPT Version :9

Sequence 1:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:295 Identity:66/295 - (22%)
Similarity:116/295 - (39%) Gaps:97/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LIDEYLSGDEKIFQEVAARLKRKPTKLERGCRGEWPKKSSPELICRYN----RDTSAFLKLA--- 299
            ||....:.||.:.::|:.     ..|:|.       |.....|:|..:    ..|.:.:|:|   
plant    28 LIQHINTFDELVGEQVSV-----DVKIEE-------KTKDMILLCSLSPLLTTLTCSMVKVAASL 80

  Fly   300 --PLK--LEFLSVQPMILLYHDVL-------YENE------------------FKSMRDIAMYNG 335
              |.:  ||.::.:|...:||:.|       ..||                  ..::..:...:.
plant    81 RFPNERWLEVITKEPRAFVYHNFLALFFKICKTNEECDHLISLAKPSMARSKVRNALTGLGEESS 145

  Fly   336 SMIDGWTYVDFDKKGNPKQQDRVVKMIAFQGTTAPFTLSINRRMADMSGLEMRDNMVLYLTNYGL 400
            |.....|::   :.|:    |::||             .|.:|:::.:.:...:...|.:.||.:
plant   146 SRTSSGTFI---RSGH----DKIVK-------------EIEKRISEFTFIPQENGETLQVINYEV 190

  Fly   401 GGHFGKHVDYVELAKRPPDFFADFGGDRIATALIYASDIPLGGTTVFTKLK-------IAVQPKK 458
            |..|..|.|               |..||||.|:|.||:..||.|||.:.|       ::|:|||
plant   191 GQKFEPHFD---------------GFQRIATVLMYLSDVDKGGETVFPEAKGIKSKKGVSVRPKK 240

  Fly   459 GSALIWFNLNHAGEPDPLTEHSVCPVVLGSRWIIS 493
            |.||:::::...|..||.::|       |.|..:|
plant   241 GDALLFWSMRPDGSRDPSSKH-------GKRHCLS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528
P4Hc <369..497 CDD:214780 38/132 (29%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 12/60 (20%)
P4Hc 115..262 CDD:214780 42/188 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.